SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004827 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004827
Domain Number 1 Region: 335-431
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 494-785
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.0000000000000034
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 
Domain Number 3 Region: 81-133
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000887
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Domain Number 4 Region: 257-347
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000463
Family I set domains 0.05
Further Details:      
 
Domain Number 5 Region: 179-247
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000265
Family Calmodulin-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004827   Gene: ENSLAFG00000005760   Transcript: ENSLAFT00000005761
Sequence length 847
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_61:4545401:5408898:1 gene:ENSLAFG00000005760 transcript:ENSLAFT00000005761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKCWSAVLVLGFIFLESEGRPPKEAGYVLKSYQPLVRLRHKQEKSQESSRTKGFLIQDG
PFGSCENKYCGLGRHCVISRELGRAECACMELCKRHYKPVCGSDGQFYENHCEVHRAACL
KKQKITIVHNEDCFFRGDRCETAEYSKMKNMLLDLQNQKYITQENENPNSDAIARKKILV
DQMFKYFDADNNGLVDINELTQVIKQEEFSKDLSDCTLYDLLKYEDFNSDKHLALEEFYR
AFQVIQLSLPEDQKVSVTAATVGQSAVLSCAIQGALRPPVIWKRNSIILNNLDLEDINDF
GDDGSLYITKVTTTHMGNYTCYAEGYEYVYQTHIFQVNVPPVIRVYPESQAREPGVTASL
RCHAEGIPNPQLSWLKNGIDITPKLSKQLTLQANGSEVHISNVRYEDTGAYTCIAKNEAG
VDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGIKVIQPIECEFQRHIKPSE
KLLGFQEEVCPKAEGDEVQRCVWASAVNVKDKFIYVAQPTLDRVLIVDVQSQKVVQAVST
DPVPVKLHYDKSHDQVWVLSWGTMDKTSPTLEVITLAGGNVAHHTIHTQPVGKQFDRVDD
FFIPTTTLLITHMRFGFILHKDEAALQKIDLETMSYMKTINLKDYQCIPQSLAYTHLGGY
YFIGCKPDSTGAIPPQLVVDGVTDSVIGFNSDVTGTPYVSPDGHYLVSINDMKGIVRVQY
ITIRGEIQEAFDIHTNLHISDVAFQPSFTEANQYNIYGSSSMQTDVLFVELASGKVKMIK
SLKEPLKAEDWLWNRKNRQIQDSGLFGQYLMTPSKNSLFILDGRLNKLNCEITEVEKGNT
IIWVGDA
Download sequence
Identical sequences G3SWU7
ENSLAFP00000004827 ENSLAFP00000004827 XP_003418537.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]