SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000005045 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000005045
Domain Number 1 Region: 118-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000154
Family Cripto EGF-like domain-like 0.0042
Further Details:      
 
Domain Number 2 Region: 83-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000147
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000005045   Gene: ENSLAFG00000006015   Transcript: ENSLAFT00000006015
Sequence length 184
Comment pep:novel supercontig:loxAfr3:scaffold_46:17042210:17059165:1 gene:ENSLAFG00000006015 transcript:ENSLAFT00000006015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YSRLLFMISLALQIIHLGKSYQREKHKGGKEEINNATTQKFQQKTLHWTWTLNNFSEANG
SAQGWRRPPDSPGFRRTPTGVSTQSSCCRNGGTCVLGSFCVCPAHFTGRRCEHDPKRSEC
GAHAHGAWTVRGCRLCRCVYGALHCLPRQTPGPCDLKDFLTSHSNGLSSQHTLSFLILLP
CFLL
Download sequence
Identical sequences G3SXC4
ENSLAFP00000005045 ENSLAFP00000005045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]