SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000005242 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000005242
Domain Number 1 Region: 193-467
Classification Level Classification E-value
Superfamily Mitochondrial carrier 7.06e-83
Family Mitochondrial carrier 0.0000281
Further Details:      
 
Domain Number 2 Region: 17-186
Classification Level Classification E-value
Superfamily EF-hand 7.52e-39
Family Calmodulin-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000005242   Gene: ENSLAFG00000006249   Transcript: ENSLAFT00000006249
Sequence length 477
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_11:53072873:53129932:-1 gene:ENSLAFG00000006249 transcript:ENSLAFT00000006249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRWLRGFALPAAACQEAQPPTRYETLFQQLDRNRDGVVDIRELQEGLKSLGIPLGQDAE
EKIFTTGDINKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGL
TISEKQAELILQSIDADGTMTVDWNEWRDYFLFNPATDIEEIIRFWKHSTGIDIGDSLTI
PDEFTEDEKISGQWWRQLLAGGVAGAVSRTSTAPLDRLKVMMQVHGSKSDKMNLVGGFRQ
MVKEGGVRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGA
TAQTFIYPMEVLKTRLAVGKTGQYSGIFDCAKKIMKHEGLGAFYKGYIPNLLGIIPYAGI
DLAVYELLKSHWLDNFAKDTVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLE
GSPQLNMVGLFRRIISKEGVRGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVAQK
Download sequence
Identical sequences G3SXU0
ENSLAFP00000005242 XP_003409580.1.64505 ENSLAFP00000005242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]