SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000005643 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000005643
Domain Number 1 Region: 286-347
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-21
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 2 Region: 738-795
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.33e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 680-739
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-18
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 4 Region: 642-694
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.9e-18
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 784-836
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000127
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 554-606
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000295
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000005643   Gene: ENSLAFG00000006716   Transcript: ENSLAFT00000006718
Sequence length 839
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_91:474819:505280:1 gene:ENSLAFG00000006716 transcript:ENSLAFT00000006718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVQQLEMETQRSSPLSFPSVPQNETLRQAPAGPARETLLQSRVLPSKEIPSLSPAVPRQG
SLPQAPSAPKQETSGRMPHVLQKGPSLLYPAAAEQGTHLQRPQASQEETRYPPPVAADPE
LSLLSHATHRQEAPLRSPEVPEKDPLTLSPTVPEADLDPLLQRPASQKDTPFQLSSAAQK
ETPLPTAEITRLAVWAAVQAVERKLEAQAMRLLTLEGRTGTNEKKIADCEKTAVEFANHL
ESKWVVLGTLLQEYGLLQRRLENMENLLKNRNFWILRLPPGSNGEVPKVPVTFDDVAVHF
SEQEWGNLSEWQKELYKNVMRGNYESLVSMDYAISKPDLMSQMERGERPAVQEQEDSEEG
ETPADPSAAHDGIVIKIEVQTNDEGSESLETPEPLMGQVEEHGFQDSELGDPCGEQPELD
MQEQENALEESTEGSSEFSELKQMLAQQRNCTEGIVIKTEEQDEEEEEEEEEEEEEELPP
HLQTLGQLSGRFEASMYQAPLPGELSPDGEESPPALQLGKPAMRRLAPAAHGERHLGEGR
GPASQQQRNRRGGRPFTCLECGKSFRLKINLVIHQRNHVKEGPYACAECEASFRHKQQLT
LHQRAHRGPRAPPSPERAPSLHPKHALKARPKSPGAGGGGSKPYQCPECDSSFSHKSSLT
KHQITHTGERPYTCPECKKSFRLHISLVIHQRVHAGKHEVSFICSLCGKSFSRPSHLLRH
QRTHTGERPFKCPECEKSFSEKSKLTNHCRVHSRERPHACPECGKSFIRKHHLLEHRRIH
TGERPYHCAECGKRFTQKHHLLEHQRAHTGERPYPCAHCAKCFRYKQSLKYHLRTHAGE
Download sequence
Identical sequences G3SYP9
ENSLAFP00000005643 ENSLAFP00000005643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]