SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000005681 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000005681
Domain Number 1 Region: 905-1197
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 5.76e-87
Family Complement components 0.0000115
Further Details:      
 
Domain Number 2 Region: 1278-1406
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 6.28e-32
Family Alpha-macroglobulin receptor domain 0.0011
Further Details:      
 
Domain Number 3 Region: 741-794
Classification Level Classification E-value
Superfamily E set domains 0.0000000014
Family SVA-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000005681   Gene: ENSLAFG00000006753   Transcript: ENSLAFT00000006760
Sequence length 1442
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_0:92035385:92195842:-1 gene:ENSLAFG00000006753 transcript:ENSLAFT00000006760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGQPLLTVTHLLCVWCSTLALPQPRFLVTAPGIIRPGGNVTIGVELLEHSPSQVTVKAE
VLKMASNVTTPVLEAEGVFEKGSFKTLVLPSLPLNSVNEIYELRVTGRAEDEILFSNTTL
LSFETKRMSVFIQTDKPLYKPKEEVKFRVLTLFSDFKPYKTSLSIVIKDPKSNLIQQWLS
EQNNLGVVSKTFQLSSHPILGDWSIQVQVNDQTYYQSFQVSEYVLPKFEVTLQTPLYCSL
NSKSLNGTVVAKYTYGKPVKGDVTLTFLPLSFWGVRKNYVLFLEINGSANFSFNEEEMKK
VMDFSDGLYEHMDLSSPGPVEILATVTESLTGISRNASSNVFFKQHDYIIEFFDYVTVLK
PSLNFTATVKVTRSDGNQLTLEERRNDVVITVTQRNYTDYRSRWNSRSQEMGAVQIMNFT
VPQNGIFKVEFPILDDTSELQLKGYFIDSVSSMEVHGMFKSPSKTYIQLKARNENIKVGS
PFQLVVSGNKQFKELSYMVVSRGQLVAVGKQNSATFSLTPENSWAPRACIIVFYIEDDGE
IINDVLKIPVQLAFKNKINLFWSKANAEPSEKVSLMISVTQPDSLVGIVAVDKSVNLMNA
SNDITMENVAHELELYNTGYYLGMFVNSFAVFQECGLWVLTDANLVKDYIDGVYDNPEVA
ERFVEESEGYMVDFHDFSSVSNPRVRKHFPETWIWLDANMGSKIYQEFEVTVPDTITSWA
ATAFVISEDLGLGLTTAPVELRAFQPFFIFLNLPYSVIRGEEFALEVTIFNYLKDATEVK
VIIEESDKFDILVTSNEVNATGYQQTILVPSEDGATLLFPVRPTHLGEIPITVTAVSPTA
SDALTQKILVKAEGIEKSYSQSILLDLTDNKLRNTLKTLSFSFPPETVSGSERVQITAIG
DILGPSIKGLASLIRMPYGCGEQNMINFAPNIYVLDYLTKKKQLTDNLREKALSFMRQGY
QRELLYQREDGSFSAFGNDDPSGSTWLSAFVLKCFLEADPYIDVDPNVLQRTYTWLQGRQ
KSNGEFWEPGRVIHSELQGGNKSPVTLTAYIVTSLLGYKKYQPNIDVQESINFLESEFNR
GISDNYTLALITYALSSVRSPKAQEALNMLTQRAEQEGGMQFWVSSVSKLSESWQPSSLD
IEVAAYALLSHFLQFRVPEGIAIMRWLSRQRNSLGGFASTQDTIVALKALSEFAALMNTE
STDIQVTVMGPTSPNPVKFLIDTQNRFLLQSVELPVVQPTTVNISANGFGFAICQLNVIY
NVKNSESSRRRRSLQNEEAFDLDVAVNDDEDDINHLNLSVCTRYLGPARSGMALMEVTLL
SGFAVPLDAIPRSEIIKKVEHDHGTVNLYLDSVNETQVCVDIPAVRNFKVSNTQDASVSI
VDYYEPRRRAVRTYNSKAKLSSCDLCGHVHGCHLCEKGAASSLHHSSVILVFCFMLLFSL
QR
Download sequence
Identical sequences G3SYT3
ENSLAFP00000005681 ENSLAFP00000019341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]