SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006102 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006102
Domain Number 1 Region: 40-155
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.72e-34
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 2 Region: 170-293
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-18
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 
Domain Number 3 Region: 292-328
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006102   Gene: ENSLAFG00000007257   Transcript: ENSLAFT00000007257
Sequence length 521
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_43:15722133:15761159:-1 gene:ENSLAFG00000007257 transcript:ENSLAFT00000007257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSVVSLVLLVTLLVVEGIAVAQKTQEDGQNIGIKHVPATQCGIWVRTSNGGHFASPNYPD
SYPPNKECIYILEAAPRQRIELTFDEHYYIEPSFECRFDHLEVRDGPFGFSPLIDRYCGM
KSPPLIRSTGRFMWIKFSSDEELEGLGFRAKYSFIPDPDFTYLGGILNPIPDCQFELSGA
DGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQMEHSNECKRNFVAVYDG
SSSIENLKAKFCSTVANDVMLKTGVGVIRMWADEGSRLSRFRMLFTSFVEPPCTGTTFFC
HSNMCINNSLVCNGVQNCAYPWDENHCKEKKKAGLFEQITKTHGTIIGITSGIVLVLLII
SILVQVKQPRKKVMACKTAFNKTGFQEVFDPPHYELFSLRDKEMSADLADLSEELDSYQK
MRRSSTASRCIHDHHCGSQASSTKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYT
FKQAHECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF
Download sequence
Identical sequences G3SZN9
ENSLAFP00000006102 ENSLAFP00000006102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]