SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006283 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006283
Domain Number 1 Region: 340-471
Classification Level Classification E-value
Superfamily C-type lectin-like 1.15e-41
Family C-type lectin domain 0.0000877
Further Details:      
 
Domain Number 2 Region: 199-335
Classification Level Classification E-value
Superfamily C-type lectin-like 1.44e-37
Family C-type lectin domain 0.00045
Further Details:      
 
Domain Number 3 Region: 790-917
Classification Level Classification E-value
Superfamily C-type lectin-like 3.88e-34
Family C-type lectin domain 0.00037
Further Details:      
 
Domain Number 4 Region: 924-1074
Classification Level Classification E-value
Superfamily C-type lectin-like 2.36e-33
Family C-type lectin domain 0.00045
Further Details:      
 
Domain Number 5 Region: 482-616
Classification Level Classification E-value
Superfamily C-type lectin-like 2.58e-31
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 6 Region: 624-774
Classification Level Classification E-value
Superfamily C-type lectin-like 3.04e-28
Family C-type lectin domain 0.00059
Further Details:      
 
Domain Number 7 Region: 1223-1359
Classification Level Classification E-value
Superfamily C-type lectin-like 1.63e-26
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 8 Region: 5-136
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.63e-25
Family Cysteine rich domain 0.0028
Further Details:      
 
Domain Number 9 Region: 1089-1209
Classification Level Classification E-value
Superfamily C-type lectin-like 1.4e-24
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 10 Region: 136-194
Classification Level Classification E-value
Superfamily Kringle-like 6.85e-20
Family Fibronectin type II module 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006283   Gene: ENSLAFG00000007467   Transcript: ENSLAFT00000007472
Sequence length 1443
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_31:28651260:28679997:1 gene:ENSLAFG00000007467 transcript:ENSLAFT00000007472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLPEPNVFLIFNHGLQGCLEAQGGQVRVTAACNASLPAQRWKWVSRNRLFNLGAMQCLGT
GWPGTNTTASLGMYECDREALNLRWHCSTLGDQLSLLLGGRASNATKAGTPERGDQTRSG
QWHIYGSDEDLCARPYYEVYTIQGNSHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCATT
QDYGKEERWGFCPIKSNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSI
TEIHEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSDENCG
VIRTESAGGWQNRDCSIALPYVCKKKPNATVEPTPPDVWANVKVECEPSWQPFQGHCYRL
QAEKRSWQESKKACLRGGGDLLSIHSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWS
DGSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKAGQLSQGTAD
EDHGCRKGWTWHSPSCYWLGEQVTYSEARRLCTDHGSQLVTITNRFEQAFISSLIYNWDG
EYFWTALQDLNSTGSFRWLSGDEVMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCTA
FRARYICRQSLGTPVTPELPGPDPTPSLSGTCPQGWASDPKLRHCYKVFSSDRLQDKRSW
AQAQGACQELGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQHWFWMGLNRRDPGAGQ
SWRWSDGLGFSYHNFDRSRHDDDDIRSCAVLDLASLQWMAMQCETQLDWICKIPRGTDVR
EPDLSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELASVHSQAELDFLGHNLQ
KFSRGQEQHWWIGLHTLENNGRFRWTDGSIINFISWAPGKPRPIGKDKKCVYMTANREDW
GDQRCLTALPYICKRSNTTRETQPPDLLPTTLGGCPSGWNQFLNKCFRIQGDDPQDRVKW
SEAQFSCEQQEAQLVTIANPLEQAFITTSLPNVTFDLWIGLHASQRDFQWVEQEPLLYAN
WAPGEPSGPSPAPSGNKPTSCVVVLHSLSAPFTGRWDDRSCTEETHGFICQKGTDPSLSP
SPAALPPAPGTDLSYLNGTFRLLQKPLRWHDALLLCESRNASLARVPDPYTQAFLTQAAR
GLRTPLWIGLASEEGSRQYSWVSEEPLGYVSWQDGEPQQPGGCAYVDMDGSWRTTSCETK
LQGAVCGVNGGPRPPRKISYHGSCPQGLADSAWIPFREHCYSFHLELLLGHKEALQRCQR
AGGAVLSILDEVENVFVWEHLQSSEGQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPP
GLGPSMLSHNSCYWIQSSSGLWRPGACTNITMGVVCKLPRAEESSFSPSAALPENPAALV
VVLMAVLLLLALLTAALILYRRRKSIERGAFEGARYSRSSSGPSEATEKNILVSDMEMNE
QQD
Download sequence
Identical sequences G3T027
ENSLAFP00000006283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]