SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006697 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006697
Domain Number 1 Region: 312-437
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000601
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000006697
Domain Number - Region: 39-91
Classification Level Classification E-value
Superfamily HR1 repeat 0.00254
Family HR1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006697   Gene: ENSLAFG00000007986   Transcript: ENSLAFT00000007985
Sequence length 564
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_27:26527217:26544175:-1 gene:ENSLAFG00000007986 transcript:ENSLAFT00000007985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFARNHRSRVTVARGSALEMEFKRGRFRLSLFSEPPEDTELQRKLDHEIRMREGACKLLA
ACSQREQALEATKSLLVCNSRILSYMGELQRRKEAQVLGKTARRPSDSGPPADRSPCRGR
VCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLGEHIEDTEMVLVDRTLTDITFQNSV
LFADAGPDFELRLELYGACVEEEGALTTAPKRLATKLSSSLGRSSGRRVRASLDSAGGSG
SSPILLPTLAVGGPRYHLLAHTTLTLAAVQDGFRTHDLTLTSHEENPAWLPLYGSVCCRL
VAQPLCMTQPTASGTLRVQQAGELQSWAQVHGVLKGTNLFCYRRPEDTDTGEEPLFTIVI
SKDTRVRAGELDQAPGRPFTLSISNQYGDDKVMHTLQTESRGALQSWMEALWQLFFDMSQ
WKQCCDEIMKIETPAPRKPPQAVAKQGSLYHEMAIEPLDDIAAVTDILAQREGPRLETPP
PWLAMFTDQPALPSPCSPASVAPAQARTHPLLWGRPRTFSLDAVPPDHSPGASRSVAPLP
SQRSPRSRGLCSKGPPHTWLQSPV
Download sequence
Identical sequences G3T0Z3
ENSLAFP00000006697 XP_003413738.1.64505 ENSLAFP00000006697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]