SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000007213 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000007213
Domain Number 1 Region: 104-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000219
Family EGF-type module 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000007213   Gene: ENSLAFG00000008592   Transcript: ENSLAFT00000008589
Sequence length 208
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_1:58033640:58044093:-1 gene:ENSLAFG00000008592 transcript:ENSLAFT00000008589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLPSVVLKLLLATVLSALVTGESLERIRRGVAAGTRKPDPPTGSTDQLLPSGDARSRE
VLDLDEANLDLFRVAFSSKPQAQATPSKEEYGKRKKKGKGLGKKRDPCLRKYKDFCIHGE
CRYVKKLRAPSCLCQPGYHGERCHGLTLPVENRLYSYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYNVENEEKVKLGMTNSH
Download sequence
Identical sequences G3T245
XP_003404583.1.64505 ENSLAFP00000007213 ENSLAFP00000007213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]