SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000007947 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000007947
Domain Number 1 Region: 221-491
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.64e-65
Family TNF-alpha converting enzyme, TACE, catalytic domain 0.000000000795
Further Details:      
 
Domain Number 2 Region: 503-577
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.000000000000118
Family Blood coagulation inhibitor (disintegrin) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000007947   Gene: ENSLAFG00000009473   Transcript: ENSLAFT00000009475
Sequence length 845
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_20:18959732:19006923:-1 gene:ENSLAFG00000009473 transcript:ENSLAFT00000009475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQCLLFLTSLVSFVLAPRPPDDPGYGSQQRLEKLDYLLSDYDILSLSSIQQHSVRKRDL
QTSTHLETLLTFSALKRHFKLYLTSSTERFSQNFKVVVVDGKNESEYTVKWQDFFSGHVV
GEPDSRVLAHIGDDDVTIRINTDGAEYNIEPLWRFINDTRDKRMLVYKSDDIKNVSRLQS
PKVCGYLKMDNEELLPKGLVDREPPKELVHRVKRRAEPNPLKNTCKLLVVADHRFYKYMG
RGEESTTTNYLVSISVIKMSLLSLSLLNTQIELIDRVDDIYRNTSWDNAGFKGYGIQIEQ
IRILKSPEKVKPGEKHYNMEKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQ
DFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADL
VTTHELGHNFGAEHDPDGLAECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKT
IESKAQECFQERSNKVCGNSRVDEGEECDPGIMYLNNDSCCNNDCTLKQGVQCSDRNSPC
CKNCQFETAQKKCQEAINATCKGVSYCTGNSSECPPPGNADDDTVCLDLGKCKDGKCIPF
CEREQKLESCACNETDNSCKVCCRDRAGRCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKC
EKRVQDVIERFWSFIDKLSINTFGKFLADNIVGSVLVFSLVFWIPFSILVHCVDKKLDKQ
YESLSLFHPSNVEMLSSMDSASVRIIKPFPTPQTPGRLQPLQPAPVMPPVAVPPKLDHQR
MDTIQEDPSTDSHIDEDVFEKDPFPNSTAAKSFEDLTDRPVTRSEKASSFKLQRQNRVDS
KETEC
Download sequence
Identical sequences G3T3T3
ENSLAFP00000007947 ENSLAFP00000007947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]