SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008183 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008183
Domain Number 1 Region: 50-155
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-32
Family Spermadhesin, CUB domain 0.00018
Further Details:      
 
Domain Number 2 Region: 170-294
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.85e-19
Family Spermadhesin, CUB domain 0.0045
Further Details:      
 
Domain Number 3 Region: 292-328
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000367
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008183   Gene: ENSLAFG00000009759   Transcript: ENSLAFT00000009761
Sequence length 534
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_4:27685930:27849030:1 gene:ENSLAFG00000009759 transcript:ENSLAFT00000009761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIHGRAVLHIVASLIILHLSGATKKGTAEKQTTSETQKSVQCGTWTKHADGGVFTSPNYP
SKYPPDRECIYIIEAAPRQCIELYFDEKYSIEPSWECKFDHIEVRDGPFGFSPIIGRFCG
QQNPPVIKSSGRFLWIKFFADGELESMGFSARYNFTPDPDFKDLGVLKPLPACEFEMGGP
EGIVESVQIMKEGKASASEAVDCKWYIRAPPRSKIYLRFLDYEMQNSNECKRNFVAVYDG
SSSVEDLKAKFCSTVANDVMLRTGLGVIRMWADEGSRNSRFQMLFTSFQEPPCEGNTFFC
HSNMCINNTLVCNGLQNCVYPWDENHCKEKRKANLLDQLTNTSGTVIGVTSCIVIILIII
SVIVQIKQPRKKYVQRKSDFDQTVFQEVFEPPHYELCTLRGTGAAADFADVPDDFENYHK
LRRSSSKCIHDHHCGSQLSSAKGSRSNLSTRDASVLTEMPPQPVKPLIPPVSRRNILVMK
HNYSQDAADACDIDEIEEVPTTSHRLSRHDKAVQRFCLIGSLSKHESEYNTTRV
Download sequence
Identical sequences G3T4B1
ENSLAFP00000008183 ENSLAFP00000008183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]