SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008773 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008773
Domain Number 1 Region: 189-391
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-53
Family DBL homology domain (DH-domain) 0.00000164
Further Details:      
 
Domain Number 2 Region: 2-213
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-39
Family Calponin-homology domain, CH-domain 0.0033
Further Details:      
 
Domain Number 3 Region: 656-757,834-860
Classification Level Classification E-value
Superfamily SH2 domain 1.35e-24
Family SH2 domain 0.0009
Further Details:      
 
Domain Number 4 Region: 784-862
Classification Level Classification E-value
Superfamily SH3-domain 2.85e-19
Family SH3-domain 0.00082
Further Details:      
 
Domain Number 5 Region: 378-538
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-17
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 6 Region: 559-645
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000158
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008773   Gene: ENSLAFG00000010474   Transcript: ENSLAFT00000010477
Sequence length 866
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_226:56409:264840:1 gene:ENSLAFG00000010474 transcript:ENSLAFT00000010477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQWRQCGRWLIDCKVLPPNHRVVWPSAAVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSI
AQNKGIRPFPSEETAENDDDVYRSLEELADEHDLGEDIYDCVPCEDEGDDIYEDIIKVEV
QQPMKMGMTEDDKRSCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPGDMAAIFTNLE
DLIKVHHSFLRAIDLSMMAGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLAGRE
DFRQKVEECTLKVQEGKFKLQDLLVVPMQRVLKYHLLLKELLSHSTDRPERQQLKEALEA
MQDLAMYINEVKRDKETLKKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDS
GLGLAHTGMAVCRYTYMYTLEHTLRHGRMCTQDRHVSCLLLQWSYGFYLVHLQGKQGFQF
FCKTEDMKRKWVEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACKMFLRGTFYQGY
LCTKCGVGAHKECLEVMPPCKISFPADPDASGAGPGPKMVAVQNYHGNPAPPGKPVLTFQ
TGDVMELLRGDPESQWWEGRLVQTRKLGYFPSSSVKPCPVDGRPPIGRPPSREIDYTAYP
WFAGNMERQQTDNLLKAHASGTYLVRERPAEAERFAISIKFNDEVKHIKVVEKDSWIHIT
EAKKFESLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERVACRASSRSPASCAFYNFSF
LSPQGLSFASQGSSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREGDVVKIYSRIGGD
QGWWKGEANGRIGWFPSTYVEEEGIQ
Download sequence
Identical sequences G3T5P5
ENSLAFP00000008773 ENSLAFP00000008773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]