SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008802 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008802
Domain Number 1 Region: 118-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000222
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 2 Region: 27-154
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000659
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008802   Gene: ENSLAFG00000010516   Transcript: ENSLAFT00000010516
Sequence length 676
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_26:28783365:28797475:-1 gene:ENSLAFG00000010516 transcript:ENSLAFT00000010516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSPEPPPSVPALCLLLMLSGAGSQTASCASWCPPNSTCDSATTCRCNPGFSSPLGESIIS
PAESCDDINECGPPAKVSCGKLADCQNVEGSYYCTCVPGYELASGGKTFRNESENTCQDV
NECSLKQNPCHNTTHCLNTVGGYKCRCRPGWKPIPGSPNGPNNTICEEMHFPSWTRPSEV
NSSQSLSRFFDKVQDLDRDFKPDLAKRTIQKLIMYLDELLEAPGDLEDLNPSTQHHIATS
LLLGLEQVLRTLAQALPEPSFTYRSPSKTELSLMIQKQEKDGNRSVIVGQSHARMQLEWA
VAGQDKDSGDGHGHTVVGILSSPNMKRLLANASLDMEPSKKAKLEETHENPVHGAQLKVL
SAVNSVFLSNTNTEKLDSPVTFAFSHLQPETPGPRQELICAFWKGDNDRGGHWATTGCWK
LGSENGSTTCQCSHLSSFAILMAHYNVEDPKLALITKVGLALSLVCLLLCILTFLLVRPI
QSSRTTVHLHLCICLFVGSAIFLAGVENEGGQVGLRCRLVAGLLHYFFLAVFCWMSLEGV
ELYFLVVRVFQGQGLSTRWLCLIGYGTPGVIVGVSAAVSAAALNSQGYGRISYCWLDLAH
GFLWSFLGPVTFIVLCNAVIFVITVWKLTQKFSEINPDMKKLKKARVLTITAVAQLFVLG
CTWVFGPGPLQPSSWV
Download sequence
Identical sequences G3T5R9
ENSLAFP00000008802 ENSLAFP00000008802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]