SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009234 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009234
Domain Number 1 Region: 179-302
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 3.4e-60
Family Dystroglycan, domain 2 0.000000371
Further Details:      
 
Domain Number 2 Region: 495-596
Classification Level Classification E-value
Superfamily Cadherin-like 2.04e-18
Family Dystroglycan, N-terminal domain 0.017
Further Details:      
 
Domain Number 3 Region: 60-158
Classification Level Classification E-value
Superfamily Cadherin-like 1.07e-17
Family Dystroglycan, N-terminal domain 0.0000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009234   Gene: ENSLAFG00000011041   Transcript: ENSLAFT00000011037
Sequence length 893
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_12:17892206:17909680:-1 gene:ENSLAFG00000011041 transcript:ENSLAFT00000011037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSLLLLPPLWGRTFLLLLLVALAQSRWPSEPSETVRDWENQLEASMHSVLSDLREAVP
TVVGIPDGMAVVGRSFRVTIPTDLIASSGEVIKVSAAGKETLPSWLHWDPKSHALEGLPL
DTDKGVHYISVSAARLGSNGSHIPQTSSVFSIEVYPEDHSEPQSVRAASPEPGEVVASTC
AADEPVTVLTVILDADLTKMTPKQRIDLLHSMQSFSGVELHNMKLVPVVNNRLFDMSAFM
AGPGNAKKVVENGALLSWRLGCSLNQNSVPDIRGVEAPAREGAMSAQLGYPVVGWHIANK
KPPLPKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPV
PGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTMVSGQIRPTMTIPGYVEPTAVATPPTT
TTKKPRVSTPKPATPSTDSSTTTTRRPTKKPRTPRPPLRATTKVPITRLETASPPTRIRT
TTSGVPQGGEPNQPPELKNHIDRVDAWVGTYFEVKIPPDTFYDKEDTTTDKLKLTLKLRE
QQLVGEKSWVQFNSTSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHKRPQGD
RAPARFSAKFVGDPAPVVNDIHKKIALVKKLAFAFGDRNCSTITLQNITRGSIVVEWTNN
TLPLEPCPKEQITGLSRRIAEDDGKPRPAFSNALEPDFKAMNVAVMGSGSCRHLQFIPVT
SPRKVPSETPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKGK
LTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETTPL
NQDAVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences G3T6Q9
ENSLAFP00000009234 ENSLAFP00000009234 XP_003409702.1.64505 XP_010588100.1.64505 XP_010588101.1.64505 XP_010588103.1.64505 XP_010588104.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]