SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009274 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009274
Domain Number 1 Region: 309-440
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.82e-33
Family SPRY domain 0.00044
Further Details:      
 
Domain Number 2 Region: 8-78
Classification Level Classification E-value
Superfamily RING/U-box 5.74e-19
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 85-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000121
Family B-box zinc-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009274   Gene: ENSLAFG00000011083   Transcript: ENSLAFT00000011083
Sequence length 441
Comment pep:novel supercontig:loxAfr3:scaffold_62:13248832:13255902:1 gene:ENSLAFG00000011083 transcript:ENSLAFT00000011083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSNISQAFRKELTCCICLNYLTDPVTIGCGHSFCRPCLYISWEEAKTTRCPLCGETSKK
TDIKSNILVKNLVSLARQASLCQFLSSEDQMCGTHKETKKMFCEESKNLLCLLCSYSQEH
EAHRHCSIEYAVEKYREKLLKQMRSLWEKIQENQRNLNEECRIINLWTDYICLRRDMIRD
QYQKLHPVLHREEKQHLEGLKSERKRILQQLKKSQTTMVQKQNHLREMFEELLNLCHKPD
VELLQNLEDTLTRSESVQLHMPQPVNPALSARPITGLKDRFNQFQENLVHKHKIMKGINE
ISDTLDSRDLQEVLFQSGRSNYFATWGDQAFTSGKHYWEMHVDSSWDWAIGVCKDTWLRK
NCSVIESGDTFLLLCVKGDNGYHLFTTSPYIEKPLGKVGVFVDFNSGSVSFVNVAKNSLI
WEYPPYSFNYSLRPFFCTGHT
Download sequence
Identical sequences G3T6U5
ENSLAFP00000009274 ENSLAFP00000009274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]