SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009545 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009545
Domain Number 1 Region: 1052-1146
Classification Level Classification E-value
Superfamily Immunoglobulin 1.09e-24
Family I set domains 0.0028
Further Details:      
 
Domain Number 2 Region: 764-857
Classification Level Classification E-value
Superfamily Immunoglobulin 5.52e-22
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 860-954
Classification Level Classification E-value
Superfamily Immunoglobulin 6.25e-21
Family I set domains 0.0078
Further Details:      
 
Domain Number 4 Region: 1148-1235
Classification Level Classification E-value
Superfamily Immunoglobulin 8.83e-20
Family I set domains 0.0063
Further Details:      
 
Domain Number 5 Region: 956-1050
Classification Level Classification E-value
Superfamily Immunoglobulin 3.35e-19
Family I set domains 0.0051
Further Details:      
 
Domain Number 6 Region: 123-217
Classification Level Classification E-value
Superfamily Immunoglobulin 8.83e-18
Family I set domains 0.0093
Further Details:      
 
Domain Number 7 Region: 316-409
Classification Level Classification E-value
Superfamily Immunoglobulin 2.69e-16
Family I set domains 0.0098
Further Details:      
 
Domain Number 8 Region: 218-312
Classification Level Classification E-value
Superfamily Immunoglobulin 3.83e-16
Family I set domains 0.0082
Further Details:      
 
Domain Number 9 Region: 671-761
Classification Level Classification E-value
Superfamily Immunoglobulin 4.41e-16
Family I set domains 0.0039
Further Details:      
 
Domain Number 10 Region: 30-119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000123
Family I set domains 0.009
Further Details:      
 
Domain Number 11 Region: 408-491
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000143
Family I set domains 0.017
Further Details:      
 
Domain Number 12 Region: 577-668
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000548
Family I set domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009545   Gene: ENSLAFG00000011426   Transcript: ENSLAFT00000011427
Sequence length 1324
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_100:977209:990210:-1 gene:ENSLAFG00000011426 transcript:ENSLAFT00000011427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMLQTFTLLLFCMWLSLDMTQSFKMTVMESQPELWIETNYPQAPWENITLWCRSPSQISS
QFLLLKDKTQMTWVQPTYKTFQVSFPIGALNESNTGLYRCCYWQETGWSKPSKILELEAP
GQLPKPIFWILAESSTLPGCNVNVFCHGWLQDLVYLLFKEGYAEPVDYQVPTGTVAIFSI
DNMTPENEGVYICRTHIQILPTLWSEPSNPLKLIIAGLYPKPTLTAYPGLILAPGESLNL
RCQGPIYGMTFALMRLEDLEKSFHHKRPTKNEAYFSFRALKINDAGHYLCFYYDGSYRGS
LLSDILKIWVTGKTLPPKPWLLAQPSPVVQMGQNVSLCCQGPVDGVGLTLYKREDKPLQL
LDATNIDGDDSFFLNNVTYSDAGIYSCHYLLTWKSSIRMIAYNTMELVVVAWPSTMFKLG
KTITLQCRVPHLVLEFSLEREDGATSQKFSVDGDFIISNVEGKGAGTYSCSYRVEAHPDI
WSHRSEPLKLMGPAATGSLTWNYVLNEAIRLSLITQFVALLSVVLWIRWKCRRLRIREAW
LLRTAQGVTMLFIVTALLCCGLCNGVLTEQTEIIMPTPKPELWAETNFPLAPWKNLTLWC
RSPSSSTKEFVLLKDGTGWIATRPASELVRAAFPLGALTQSHIGSYHCHSWEEMAVSEPS
EALELVGTDILPKPVISASPPIRGQELQIQCKGWLAGMGFALYKEGEQEPVQQLGAVGKE
AFFTIQRMEDKDEGNYSCRTHTEKRPFKWSEPSEPLELVIKEMYPKPFFKTWASPVVTLG
AQVTFNCSTPQQHMSFILYKDGSEIASSDGSWASPGASAAHFLLVSVGTGDGGNYTCRYY
DFAVWSEPSDPVELVVTEFYPKPTLLAQPGPVVLPGKNVTLHCQGAFQGMRFALLQEGTQ
DPLQFQSASGNSADFILHTVGAEDSGNYSCVYYETTMSNRGSHLSMPIMIWVTDTFPKPW
LYAEPSSVIPLGQNVTLWCQGPVHEVGYILHKEGEATSMQLWGSSSDDGAFLITNISGAS
IGRYSCCYHPDWTSPIKIQPSNTLELIVTGLLPKPSLLAQPGPMVAPGENITLQCQGELP
DSTFVLVKEGAQQPLEQQRPSGYRADFWMPAVRGEDSGIYSCVYYLDSAPFVASNHSDPL
EIWVTDKPPKPSLSAWPSTVFKLGKDITLQCRGPLPGVEFVLEHDGEEAPQQFSEIGDFV
INNVEGKGIGNYSCSYRLQANPDIWSEPSDPLELVGAAGPVAQECTVGNIVRSTLIVVVV
VALGVVLAIEWKKWPRLRTRGSDTDGRDQSIALEECNQEIELGTTTNSPSSISQGTSEEL
PVPI
Download sequence
Identical sequences G3T7G2
ENSLAFP00000009545 ENSLAFP00000009545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]