SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009757 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009757
Domain Number 1 Region: 83-94,185-419
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.83e-50
Family Nuclear receptor ligand-binding domain 0.00026
Further Details:      
 
Domain Number 2 Region: 10-92
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-27
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009757   Gene: ENSLAFG00000011676   Transcript: ENSLAFT00000011678
Sequence length 433
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_6:33561426:33590724:1 gene:ENSLAFG00000011676 transcript:ENSLAFT00000011678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSVPDDRAEQRTCLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCVMSRK
QRNRCQYCRLLKCLQMGMNRKAIREDGMPGGRNKSIGPVQISEEEIERIMSGQEFEEEAN
HWSNHGDSDHSSPGNRASESNQPSPGSTLSSSRSVELNGFMAFREQYMGMPMPPHYQYIP
HLFSYSGHSPLLPPQARSLDPQSYSLIHQLVSAEDLEPLGTPMLIEDGYAVTQAELFALL
CRLADELLFRQIAWIKKLPFFCELSIKDYTCLLSSTWQELILLSSLTVYSKQIFGELADV
TAKYSPSDEELHRFSDEGMEVIERLIYLYHKFHQLKVSNEEYACMKAINFLNQDIRGLTS
ASQLEQLNKRYWYICQDFTEYKYTHQPNRFPDLMMCLPEIRYIAGKMVNVPLEQLPLLFK
VVLHSCKTSVGKE
Download sequence
Identical sequences G3T7Y7
ENSLAFP00000009757 ENSLAFP00000009757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]