SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000010597 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000010597
Domain Number 1 Region: 382-561
Classification Level Classification E-value
Superfamily SPOC domain-like 1.14e-49
Family SPOC domain 0.00032
Further Details:      
 
Domain Number 2 Region: 9-166
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.24e-31
Family Canonical RBD 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000010597   Gene: ENSLAFG00000012673   Transcript: ENSLAFT00000012672
Sequence length 563
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_12:16265474:16267165:-1 gene:ENSLAFG00000012673 transcript:ENSLAFT00000012672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEDDQRATRNLFIGNLDHSVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNL
DMAHRAKVAMSGRVIGRNPIKIGYGKANPTTRLWVGGLGPNTSLAALAREFDRFGSIRTI
DHVKGDSFAYIQYESLDAAQAACAKMRGFPLGGPDRRLRVDFAKAEEPRYPQQYQPSPLP
VHYELLPDGYTRHRTLDPDLRVRDRTPPHLLYSDRDRTFLEGDWTSPSKSSDRRNSLEGY
SRSVRSRSGERWGGDGDRGMPKPWEERRKRRSLSSDRGRTTHSPYEERSRTKGGGQQLER
GSERTPERSRKENHSGEGTKESSSNSLSNSRHGAEERSHHHHHEAPDSSHGKKARDSERN
HRTTEAEPKPLEEPKHETKKLKNLSEYAQTLQLGWNGLLVLKNSCFPTSMHILEGDQGVI
SGLLKDHTSGSKLTQLKIAQRLRLDQPKLDEVTRRIKQGSPNGYAVLLATQAAPGGPGTE
GLPTVEPGLQRRLLRNLVSYLKQKQAAGVISLPVGGSKGRDSTGMLYAFPPCDFSQQYLQ
SALRTLGKLEEEHMVIVIVRDAA
Download sequence
Identical sequences G3T9V1
ENSLAFP00000010597 ENSLAFP00000010597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]