SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011595 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011595
Domain Number 1 Region: 45-163
Classification Level Classification E-value
Superfamily PX domain 5.67e-16
Family PX domain 0.0026
Further Details:      
 
Domain Number 2 Region: 246-300
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000189
Family SAM (sterile alpha motif) domain 0.0052
Further Details:      
 
Domain Number 3 Region: 813-843
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000331
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011595   Gene: ENSLAFG00000013845   Transcript: ENSLAFT00000013847
Sequence length 867
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_57:5472009:5516230:1 gene:ENSLAFG00000013845 transcript:ENSLAFT00000013847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QITPRTETPISSVSNSLENALHTSAHSIEESLPRRPLGKHSKVSVEKIDLKGLSHKKNER
NVECSFEVLWSDSSVTSVTKSSSEVTEFISKLSQLYPEENLEKFIPCLAGPDSFYVERNH
MDLEADLRYLASLPSQILRNDHVKKFFSTSSPTQQLQSPSPGNPSLSKVGTMMGVSGRPV
CGVAGIPSPQNSTQHHMQHSASAAATLPHCAHPPGAGSALTYRAQMDTSPTILMSSSLQS
PQTQEQNGILDWLRKLRLHKYYPVFKQLTMEKFLSLTEEDLNKFESLTMGAKKKLKTQLE
LEKEKSEKRCLNPSGPASVTSSGVARVPPTSHVGPLQPMRGSHAAELRVEVEPPAHQVPR
EGSSSEYSSSSSSPMGVQAREESSDSAEENERRTEVHLEGSEKEKPVMLLNHFPSSSARP
TAQVLPVQNEAGSSAAGHHALPPQMMPTASHLAPMRLLSSVHKAERGTADVKLLSASMHS
LLSLEERGKVSGPRSSVKVDKGFGNALMDVLPAPAPHQPVQVLAAVPEGSSLSPTVSFGP
RAKVVHASALDRVMKTAQQPALVVDTSTAATGTSSSVFQVARPPIKLLVSSSVPADSAVS
GQTSCSNSVQISVPPAIINPRTALYTANTKVAFSAVSSVPVGPMQGSFCANSNTASSGSH
PSTSFANMANLTSCPAPSPSPTLSSVPENSFSTGNIPTSNPGCIVCTSCGCSGSCGSSGL
TVSYANYFQHPFSGPSMFTFPFLPFSPMCSSGYVGTQQYGGGAAFPVVHSPYSGSLAADS
VLGGQSTFAVPPMQNFMAGSAGVYQTQGLLGSSNGSSHKKSGNLSCYNCGATGHRAQDCK
QPSMDFNRQGTFRLKYAPPAESLDSTD
Download sequence
Identical sequences G3TC41
ENSLAFP00000011595 ENSLAFP00000011595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]