SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011710 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011710
Domain Number 1 Region: 485-743
Classification Level Classification E-value
Superfamily NHL repeat 4.45e-48
Family NHL repeat 0.00000872
Further Details:      
 
Domain Number 2 Region: 323-419
Classification Level Classification E-value
Superfamily E set domains 1.4e-24
Family Filamin repeat (rod domain) 0.0014
Further Details:      
 
Domain Number 3 Region: 17-92
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000243
Family RING finger domain, C3HC4 0.0054
Further Details:      
 
Domain Number 4 Region: 108-170
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000687
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011710   Gene: ENSLAFG00000013983   Transcript: ENSLAFT00000013985
Sequence length 745
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_21:44623201:44640920:1 gene:ENSLAFG00000013983 transcript:ENSLAFT00000013985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMAKREDSPGPEVQPMDKQFLVCSICLDRYRCPKVLPCLHTFCERCLQNYIPAQSLTLSC
PVCRQTSILPEQGVSALQNNFFISSLMEAMQQAPDGAHNPEDPHPLSAVAGRPLSCPNHE
GKTMEFYCEACETAMCGECRAGEHREHGTVLLRDVVEQHKAALQRQLEAVRGRLPQLSAA
IALVGGISQQLQERKAEALAQISAAFEDLEQVLQQRKQALVSDLEAIFGAKQKVLQSQLD
TLRQGQEHIGSSCSFAEQALRLGSAPEVLLVRKHMRERLAALAAQAFPERPHENSQLELV
LEVDGLRRSVLNVGALLTTSATAHETVATGEGLRQALVGQPASLTVTTKDKDGRLVRTGS
AELHAEITGPDGSRLPVPVVDHNNGTYELVYTARTEGELLLSVLLYGQPVRGSPFRVRAL
RPGDLPPSPDDVKRRVKSPGGPGSHVRQKAVRRPSSMYSTGGKRKDNPIEDELVFRVGSR
GREKGEFTNLQGVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGV
AVDTNGDIIVADYDNRWVSIFSPEGKFKTKIGAGRLMGPKGVAVDRNGHIIVVDNKSCCV
FTFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLFKF
GSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDSSGSFLSYINTSAEPLYGPQGL
ALTSDGHVVVADAGNHCFKAYRYLQ
Download sequence
Identical sequences G3TCD2
ENSLAFP00000011710 ENSLAFP00000011710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]