SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000012097 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000012097
Domain Number 1 Region: 257-493
Classification Level Classification E-value
Superfamily vWA-like 3.01e-34
Family Integrin A (or I) domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000012097   Gene: ENSLAFG00000014439   Transcript: ENSLAFT00000014441
Sequence length 946
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_15:38603417:38647114:-1 gene:ENSLAFG00000014439 transcript:ENSLAFT00000014441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRLMCFLLWLFLSEAQGLEIPTNGLPEFAEYGDLVELAPGKFQFVPENRRYQRSVPGES
GEETKDDDQVTLYSYKVQSTITSRMANTIIQSKVVNNSPLPQDVVFDVQIPKGAFITNFT
MTVDGTRFTSSIKEKTVGRALYSQARAKGKAAALVRSKALDMENFKTEVNILPGSKVQFE
LHYQEVKWRKLGSYEHRIHLQPGRLAKHLEVDIWVIEPQGLRFLHVPDTFEGHFEGVPVI
SKGNQKAHVSFRPTVPQQRKCSNCSETAVDGELVVVYDVNREEKAGELEVFNGYFVQFFA
PDNLEPIPKNILFVIDVSGSMWGIKMKQTVEAMKTILDDLRAEDQFSVVDFNHNVRTWRN
DLVSATKTQVTDAKKYIEKIQPNGGTNINEALLRAIFILNEADNLGLLDPNSVSLIILVS
DGDPTVGELKLSKIQKNVKQNIRDNISLFSLGIGFDVDYDFLKRLSNDNRGIAQRIYGNQ
DTSSQLRKFYNQVSTPLLRNIQFNYPDTAVTDVTQNSFHNYFGGSEIVVAGKADPTKLEQ
IQSIITATSASTDLVLEKAAETGGLEDFLSKDKHADPDFTKKLWAYLTINQLLAERSLAP
TAAAKKEITKTILEMSLEHHIVTPFTAMVIENDAGDERMLADSPQHDHSCCSGALYYGSK
TAASSIPPWASASPTPEIPLHARGAPVLETTPLHVIRVENDPHFIIYLPKSQKNICFNID
SEPGKILSLVSDPESVGILVNGQLIGAKKPKNNKLNTYFGKLGFYFQSEDMKIEISTENI
TLTRGSHVSILSWADTVHVINQRVLVSVRKEKTVTITLDKEMSFSVLLHRVWKKHPINVD
FLGIYIPPTNKFSPNAHGLIGQFMHEPEIHIFNERPGKNPKKPEASMEVKGQKLTVTRGL
QKDYRTDTVFGTDVPCWFVHNSGKGFIDGHYKDYLVPQLYSYLKWP
Download sequence
Identical sequences G3TD90
ENSLAFP00000012097 ENSLAFP00000012097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]