SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000012768 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000012768
Domain Number 1 Region: 2-184
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.24e-52
Family Nuclear receptor ligand-binding domain 0.00000000977
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000012768   Gene: ENSLAFG00000015250   Transcript: ENSLAFT00000015245
Sequence length 232
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_0:5812756:5926412:-1 gene:ENSLAFG00000015250 transcript:ENSLAFT00000015245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVE
IFDMLLATSSRFRKMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKIT
DTLIHLMAKAGLSLQQQHRRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEM
LDAHRLHAPTNRGGAPMEETNQNQLATMGSTSSHSMQPYYITGEAESLPTTL
Download sequence
Identical sequences G3TES0
ENSLAFP00000012768 ENSLAFP00000012768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]