SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000012902 from Loxodonta africana 76_3

(show help)
Strong hits

Sequence:	ENSLAFP00000012902
Domain Number 1	Region: 269-392,423-468
Classification Level	Classification	E-value
Superfamily	P-loop containing nucleoside triphosphate hydrolases	2.25e-27
Family	Nucleotide and nucleoside kinases	0.00023
Further Details:

Domain Number 2	Region: 57-178,211-257
Classification Level	Classification	E-value
Superfamily	P-loop containing nucleoside triphosphate hydrolases	8.04e-22
Family	Nucleotide and nucleoside kinases	0.0025
Further Details:

Domain Number 3	Region: 177-205
Classification Level	Classification	E-value
Superfamily	Microbial and mitochondrial ADK, insert "zinc finger" domain	0.0000000746
Family	Microbial and mitochondrial ADK, insert "zinc finger" domain	0.0029
Further Details:

Domain Number 4	Region: 392-420
Classification Level	Classification	E-value
Superfamily	Microbial and mitochondrial ADK, insert "zinc finger" domain	0.0000000759
Family	Microbial and mitochondrial ADK, insert "zinc finger" domain	0.0019
Further Details:

Weak hits

Sequence:	ENSLAFP00000012902
Domain Number -	Region: 13-52
Classification Level	Classification	E-value
Superfamily	Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit	0.0366
Family	Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit	0.0092
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

External link(s)	Protein: ENSLAFP00000012902 Gene: ENSLAFG00000015400 Transcript: ENSLAFT00000015398
Sequence length	479
Comment	pep:known_by_projection supercontig:loxAfr3:scaffold_6:25207284:25421900:1 gene:ENSLAFG00000015400 transcript:ENSLAFT00000015398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MDATSAPHRIPPEMPEYGEANHIFEMMQTMLEQLLIFQPKDPIPFMIDHLQRDNDNVPKI VILGPPASGKTTIAMWLCKHLNSNLLTMENLMAKKFSQLAAEATRHYQKSKTVPIRLLVR LIQERLNDEECVRRGWILDGIPETREQALMIQSLGITPRHVIVLSASDTVLIERNMGKRI DPRTGEIYHTTFDWPPESEIQNRLIEPEGISELETARKLLEYHRNIVRIMPSYPKILKVI SSDQPCVDVFYQALTYVQTNHRSNAPFTPRVLLCGPVGSGKSLQAALLAQKYGLVNVCCG QLLKEAVTDKSRFGELIRPFFEKKMAVPDNIILKVLTKRLNQQDCIQRGWVIHGYPRDLD QAHLLESLGHKPNRVFFLNVPLDSVIERLTLRRTDPVTGERYHLMYKPPPTMEIQARLLQ NPKDAEEQVKLKMDLFYRNSADLEGFYTRAITINGDQDPYTVFEYIESGIINPLPKKVP
Download sequence
Identical sequences	G3TF26 XP_003407533.1.64505 ENSLAFP00000012902 ENSLAFP00000012902

SEARCH