SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000013983 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000013983
Domain Number 1 Region: 845-901
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000235
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 2 Region: 668-725
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000249
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 3 Region: 726-782
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000275
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 4 Region: 905-956
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 5 Region: 45-79
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000275
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 615-665
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000128
Family TSP-1 type 1 repeat 0.0078
Further Details:      
 
Domain Number 7 Region: 786-839
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000017
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000013983   Gene: ENSLAFG00000016658   Transcript: ENSLAFT00000016658
Sequence length 1007
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_28:2698979:3385825:1 gene:ENSLAFG00000016658 transcript:ENSLAFT00000016658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSVLGSLLLLGFQLVCPQPSTEHRKVPQRMAAAKGAPEDGGGGAPGVWGAWGPWSACSRS
CSGGVMEQTRPCLPGSYRARGLSRSTAPARAFAGHVVSAVRTSVPLHRSGEEPRALNAGR
QGHAVLRGSRHPQARAREPTAERRSKTRGPIGPGKYGYGKAPYILPLQTDTGHTPQRLRR
QRSSPRHSRSQGASSPRHGYSPPASRAPQHGSLYQSDNGPLSGLQASEASIYQLPLTHDQ
GFSAASSLFHSLETSSNHGVGSHRAPQSFSQPAWSTAISCIGAYRQYKLCNTNVCPESSR
SIREVQCASYNNKPFMGRFYEWEPFAEVKGNRKCELNCQAMGYRFYVRQAEKVIDGTPCD
ENGTSICCSAFLQSIGCDDYLGSDKVVDKCGVCGGDNTGCQVVSGVFKHALTSLGYHRVV
EIPQGATKINITEMYKSNNYLALRSRSGRSIINGNWAIDRPGKYEGGGTMFTYKRPNEIS
STAGESFLAEGPTNEILDVYMIHQQPNPGVHYEYVIMGTNAINPQVPPHRRPGEPFNGQL
APEGRSQDEGEEKERSEEKEGVRGEAPEIDTAESARTFPVRQPDRLSSHRPDSLVPPAPQ
SPRRSRDHNWKQLGTTECSTTCGKGSQYPVFRCVNRNTHKEVPESYCDSSMKPTPEEEPC
NIFPCPAFWDIGEWSECSKTCGLGMQHRQVLCRQVYANRSLTVQPYRCQHLEKPETTSTC
QLKICSEWQIRTDWTSCSVPCGVGQRTRDVKCVSNIGDVVDDEECNMKLRPNDIENCDMG
PCAKSWFLTDWSERCSAECGAGVRTRSVVCMTNHIGSLPLEGCGNNRPAEATPCDNGPCA
GKVEWFAGSWSQCSIECGSGTQQREVICVRKNVDTFEVLDPYECSFLERPPSQQSCHLKP
CGAKWFNTEWSMCSKSCQGGFRVREVRCLSDDMTLSNLCDLQLKPEERESCNPQDCVPEV
DENCKDKYYNCNVVVQARLCVYNYYKTACCASCTRVANRRPGYLGSR
Download sequence
Identical sequences G3THE8
ENSLAFP00000013983 ENSLAFP00000013983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]