SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000014013 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000014013
Domain Number 1 Region: 20-257
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.26e-48
Family Nuclear receptor ligand-binding domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000014013   Gene: ENSLAFG00000016698   Transcript: ENSLAFT00000016697
Sequence length 260
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_34:5018355:5020136:-1 gene:ENSLAFG00000016698 transcript:ENSLAFT00000016697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSQPAACPCQGAAGRPAILHALLSPSLRARPFVPPTHSRCLCQQHKPVRLCTPHRTCQ
EALDVLGKTVAFLKNLPSFCQLPPQDQRRLLRDCWGPLFLLGLAQDTVTFEVAEVPVASI
LKKILLEEPGSSGSSSQLPDRPQPSLAAVQWLQCCLESFWSLELGPKEYAYLKKTILFNP
DVPGLLAPSHIGYLQQEAHQALCEVLEAWWPIGQGRLARILLMASTLKSIPPGLLGDLFF
RPVIGDVDMAGLLEDMLLLS
Download sequence
Identical sequences G3THH1
ENSLAFP00000014013 ENSLAFP00000014013 XP_003415309.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]