SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000014058 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000014058
Domain Number 1 Region: 112-293
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-31
Family SPRY domain 0.014
Further Details:      
 
Domain Number 2 Region: 326-476
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000427
Family Nucleotide and nucleoside kinases 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000014058   Gene: ENSLAFG00000016754   Transcript: ENSLAFT00000016758
Sequence length 739
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_99:4881604:4911807:1 gene:ENSLAFG00000016754 transcript:ENSLAFT00000016758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNITRQNQFYESQVIKQENESGYERRPLEMEPQQQAYRPVEMKTEMKPEVPTSFFPHEA
SQPKPDRQQFQSRKRPYEENRGRGYFEHREDRRHRGRSPQPPAEEDEDDFDDTLVAIDTY
NCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTE
PDPHVVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFE
CGNDVELSFTKNGKWMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPG
FTFIQHLPLGERIRGTVGPKSKADCEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTN
AIMDKMRVMGLRRQRNYAGRWDVLIQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRR
KMRPFEGFQRKAIVICPTDEDLKDRTIKRTDEEGKDVPDHAVLEMKANFTLPDVGDFLDE
VLFIELQREEADKLVRQYNEEGRKAGPPPEKRFDNRGGGGFRGRGGGGGFQRYDNRAPPG
GNRGGFQNRGGGGGGGGNYRGGFNRSGGGGYNQNRWGNNNRDNNNSNNRGSYNRTPQQPS
YSPARNPPGASSYNKNSSIPGSSVNTSTPTVSSYSPPQPSYSQPPYNQGGYTQAYTAPPP
PPPPPPAYNYGTYGGYNPAPYTPPPPPAAQTYPQPSYNQYQQYAQQWNQYYQNGQWPPYY
GNYDYGSYSGSTQGGTSTQ
Download sequence
Identical sequences G3THK3
ENSLAFP00000014058 ENSLAFP00000014058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]