SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000014495 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000014495
Domain Number 1 Region: 188-391
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-52
Family DBL homology domain (DH-domain) 0.000000275
Further Details:      
 
Domain Number 2 Region: 2-225
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-38
Family Calponin-homology domain, CH-domain 0.0056
Further Details:      
 
Domain Number 3 Region: 378-540
Classification Level Classification E-value
Superfamily PH domain-like 2.67e-32
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 4 Region: 667-768,817-843
Classification Level Classification E-value
Superfamily SH2 domain 2.99e-27
Family SH2 domain 0.00051
Further Details:      
 
Domain Number 5 Region: 587-697
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000508
Family SH3-domain 0.0017
Further Details:      
 
Domain Number 6 Region: 784-832
Classification Level Classification E-value
Superfamily SH3-domain 0.000000022
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000014495   Gene: ENSLAFG00000017279   Transcript: ENSLAFT00000017286
Sequence length 847
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_11:52374490:52792147:-1 gene:ENSLAFG00000017279 transcript:ENSLAFT00000017286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPWKQCAQWLIHCKVLPTNHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRAHSINLKEI
NLRPQMSQFLCLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPT
ALATGIRPFPTEESINDEDIYKVLPDLIDETCADDEEGLYDCVYGEDEGGEVYEDLMKAE
EAQQPKCPENDIRSCCLAEIKQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPE
LVKVHRSLLQEIHDSIVNKNDQNLYQIFINYKERLVIYGQYCSGVESAISSLDKISKTKE
DVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDSTEKANLKLALDA
MKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQER
HIFLFDLAVIVCKRKGYNYEMKEIIDLQQYKITNNPTTDKENKKWSYGFYLIHTQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTACKVCQMLLRGTFYQ
GYLCFKCGARAHKECLGRVDNCGRVNSAEQGTLKPPEKRTNGLRRTPRQMDPGLPRMQVI
RNYTGMPPPALHEGPPLHIQAGDTIELLKGDAHSMFWQGRNFASGEVGFFPSDAVKPCPC
VPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIK
ILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSTGQRGSRA
GSNLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPS
TYVEEDE
Download sequence
Identical sequences G3TIL1
XP_003409579.1.64505 ENSLAFP00000014495 ENSLAFP00000014495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]