SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000014818 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000014818
Domain Number 1 Region: 1148-1343
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.88e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000265
Further Details:      
 
Domain Number 2 Region: 938-1061
Classification Level Classification E-value
Superfamily PH domain-like 3.29e-32
Family Pleckstrin-homology domain (PH domain) 0.000000459
Further Details:      
 
Domain Number 3 Region: 41-166
Classification Level Classification E-value
Superfamily PDZ domain-like 1.14e-20
Family PDZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000014818   Gene: ENSLAFG00000017666   Transcript: ENSLAFT00000017671
Sequence length 1962
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_15:18951650:19122011:1 gene:ENSLAFG00000017666 transcript:ENSLAFT00000017671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMATRQTGLPEGDGDKLKASGSPACEVSKNKDGKEQSETVSPSEDETFSWPGPKTVTLKR
TSQGFGFTLRHFIVYPPESAIQFSYKDEENGNRGGKQRNHLEPMDTIFVKQVKEGGPAFE
AGLCTGDRIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKDEDILQVLQFTKDVTAL
AYSQDAYLKGNVAYSGNARNIPEPPPICYPWLTSVPSAMAQPAEISPPESSLGKQQTSTP
VLTQPGRAYRMEIQVPPSPTDVAKSNTAVCVCNESVRTVIVPSEKVVDLLSNRNNHTGPS
HRTEEVRYGVNEQTPLKPVSRTTSPSSIPTAHLIHQTSGSRLLEPSGILLKSGNYSGHSE
GLSSNRSQVGDSPSVSVNHYSPNSHQHIDWKNYKTYKEYIDNRRLHIGCWTIKERLDSLR
AASQSTPGYNQGVPNRTTLQVRRRSTSHDRGPQSVQIRQRSVSQERLEDPVLMKYCPRSA
SQGALTSPPVGFSNHRTRSWDYIGGQDETVENVNPESQIPDSNGERKQTYKWSGFTEQDD
RRGIYERPRQQEIHKSFRGSNFSVAPSVVNSDNRRISGRGMGPVSQFKKTPPDLKTLQSN
RNFPTTCGMSQARGISQDRSPLVKVRSNSLKGPSTYVAKPSFNQSSSASVKDQRPVNHVH
QNSLINQQTWLRTESAPDPQVETAKSPSLPGASVKLVPQMSENSGTSDFELSVSQRNQDL
NVQEAEIQQSGVLDNKETVVLREKPPSGRQTPQPLRHQSYILAVNDQETGSDTTCWLPND
ARREVHIKRMEERKASSTSPPGDSLASIPFIDEPTSPSIDHDIAHIPASAVISASTSQVP
SIATVPPSLTTSAPLIRRQLSHDHESVGPPSLDGQPSSKTERSKSYDEGLDDYREDAKLS
FKHVTSLKGIKIVDSQKSSEDSGSRKDSSSEVFSDAAKEGWLHFRPLVTDKGKRVGGSIR
PWKQMYVVLRGHSLYLYKDKREQTTPSEEEQPISVNACLIDISYSETKRKNVFRLTTSDC
ECLFQAEDRDDMLAWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNSLMSKAEQLPKTPR
QSLSIRQTLLGSKSEPKTQSPHSPKEESERKLLSKDDTSPPKDKGTWRKGIPSIMRKTFE
KKPTATGTFGVRLDDCPPAHTNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQ
EELNKGMADIDTQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLERL
KTLKRLIHDLPEHHFETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTH
MVTHMPDQYKIVETLIQHHDWFFTEEGAEEPLTTVQEDSTVDSQPVPNIDHLLTNIGRTG
VSPGDVSDSATSDSTKSKGSWGPGKEQYSRELLVSSIFAAASRKRKKPKEKAQPSSSEDE
LDNVFFKKENAEQRHDDIKEESKKESEVLGRKQRIIISKENSAKKDTNATKDEKTSLRKD
SIPSEEPSPPRNSRHNKSPTLSSRFTVLKESPRSLLTQKSSHFEETGSDSGTLLSTSSQA
SLARFSTKKSSSPETKHSEFLTHVSTITSDYSTTSSTTYLTSLDSSRLSPEVQSVAESKG
DEADDERSELISEGRPVETDSENDFPVFPTALTSERLFRGKVQEGTKTSRRNSEGSEASC
TQGSLTPSLDGRRQLFSSHKLIECDTLSRKKSARFKSDSGSLGDAKNEKETPSITKVFDV
MKKGKSTGSLLTPTRSESEKQEPTWKTKIADRLKLRPKAPADDMFGVGNQKTSGETAKRK
NIKRRHTLGGHRDATEMSVLNFWKAHEQSGEREPELSAVNRLKPKCSAQDLSISDWLARE
RLRPTTSDLSRGEPGDPQPENTSTLEVSTTDTPLSFQSDTGSSSSTLASTNKPLLSIPPQ
PPDQINGESFQNVSQNASSAANAQPHKLCETPGNKAEFPPCL
Download sequence
Identical sequences G3TJB9
ENSLAFP00000014818 ENSLAFP00000014818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]