SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000015169 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000015169
Domain Number 1 Region: 355-565
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-49
Family DBL homology domain (DH-domain) 0.00068
Further Details:      
 
Domain Number 2 Region: 547-679
Classification Level Classification E-value
Superfamily PH domain-like 7.45e-29
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 3 Region: 808-904
Classification Level Classification E-value
Superfamily PH domain-like 6.85e-23
Family Pleckstrin-homology domain (PH domain) 0.0006
Further Details:      
 
Domain Number 4 Region: 659-773
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.97e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000015169   Gene: ENSLAFG00000018095   Transcript: ENSLAFT00000018099
Sequence length 946
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_85:3404073:3449316:-1 gene:ENSLAFG00000018095 transcript:ENSLAFT00000018099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGHRAPGGAGPSEPEHPAANPPVAALPACADSYLGVSEPGLPVPRGSASALCGPLDSQL
AGPSDASSGAAPGPRVLPCRPSPQHHRALRFSYHLEGLQPRPGLHQGNRILVKSLSLDPG
QSLEPHPEGPQWLRSDPGPPTETPSQRPSPLKRAPGPKPQVPPKPSYLQMPRMLPPPEPI
PPPPSRPLPADPRVAKGLAPRVEAGPSSAAVSSLIEKFEREPVIVASDRPALGPSPGPIE
PASQPPVPALPEGEASRCLFLLAPGPRDGEKMPNRDSGIDSISSPSNSEPEYLLCQNQAQ
VWGLRPGSAGMADIFILFCFPYTPGTQKAFPDNELRGRMVEDDGSRVTYSPSQLTVQQKV
FHIANELLQTEKAYVSRLHLLDQVFCARLLEEARNRSSFPADVVHGIFSNICSIYCFHQQ
FLLPELEKRMEEWDRYPRIGDILQKLAPFLKMYGEYVKNFDRAVELVNTWTERSTQFKVI
IHEVQKEEACGNLTLQHHMEPVQRIPRYELLLDYLLKLPHGTQDKGSSEEESLELIATAA
EHSNAAIRKMERMHKLLKVYELLGGEEDIVSPTKELIKEGHILKLSAKNGTTQDRYLILF
NDRLLYCVPRLRLLGQKFSVRARIDVDGMELKESSNLNLPRTFLVSGKQRSLELQARTEE
EKKDWVQAINSTLLKHEQTLETFKLLNSTNREDEDTPPNSPNVDLGKRAPTPIREKEVTM
CMRCQEPFNSITKRRHHCKACGHVVCGKCSEFRARLIYDNNRSNRVCTDCYVALHGVPGS
NPACNQHTPQRRRSILEKQASVAAENSIICSFLHYMEKGGKGWHKAWFVVPENEPLVLYI
YGAPQDVKAQRSLPLIGFEVGPPEAGERPDRRHVFKITQSHLSWYFSPETEELQQRWMDV
LGRAGRGDTFCPGPTLSEDREMEEAMVAASGATAEPPEGSPDPRKL
Download sequence
Identical sequences G3TK51
ENSLAFP00000015169 ENSLAFP00000015169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]