SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000015222 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000015222
Domain Number 1 Region: 138-380
Classification Level Classification E-value
Superfamily vWA-like 1.67e-84
Family Integrin A (or I) domain 0.000000214
Further Details:      
 
Domain Number 2 Region: 638-726
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.7e-22
Family Integrin beta tail domain 0.0011
Further Details:      
 
Domain Number 3 Region: 355-468
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-19
Family Integrin domains 0.0014
Further Details:      
 
Domain Number 4 Region: 24-83
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000173
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 5 Region: 595-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000279
Family Integrin beta EGF-like domains 0.0039
Further Details:      
 
Domain Number 6 Region: 554-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000114
Family Integrin beta EGF-like domains 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000015222
Domain Number - Region: 520-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0209
Family Integrin beta EGF-like domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000015222   Gene: ENSLAFG00000018167   Transcript: ENSLAFT00000018168
Sequence length 798
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_97:3961895:3993594:1 gene:ENSLAFG00000018167 transcript:ENSLAFT00000018168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLQLIFWIGLISSICYVFSQTDENRCLKANAKSCGECIQAGPNCGWCTNLTFLQEGMPT
SARCDDLEALKKKGCHPDDIENPRGSKNIKKNKNVTNRSKGTAEKLQPEDITQIQPQQLV
LQLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMKRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIHLIIDAYNSLSSEVILENSKLPEGVTINYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITSNKCPNKNSETIKIKPQGFTEDVEIILQFICECECQSKGIPESPQCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAHCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGEVCGGNGVCKCRVCECNPNYTGSACECSLDTSSCM
AKNGQICNGRGVCECGTCKCTDPKFQGPTCEMCQTCLGVCAEHKECVQCRAFNKGEKKEK
CADECSHFNLTKVENRDKLPQPGQVDPLSHCKEKDVDDCWFYFTYSVNGNNEAIVHVVET
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
Download sequence
Identical sequences G3TK94
ENSLAFP00000015222 ENSLAFP00000015222 XP_003420767.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]