SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000015550 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000015550
Domain Number 1 Region: 170-375
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-52
Family DBL homology domain (DH-domain) 0.00000000882
Further Details:      
 
Domain Number 2 Region: 2-235
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.76e-46
Family Calponin-homology domain, CH-domain 0.004
Further Details:      
 
Domain Number 3 Region: 380-542
Classification Level Classification E-value
Superfamily PH domain-like 5.41e-34
Family Pleckstrin-homology domain (PH domain) 0.0053
Further Details:      
 
Domain Number 4 Region: 666-767,811-837
Classification Level Classification E-value
Superfamily SH2 domain 3.08e-26
Family SH2 domain 0.00059
Further Details:      
 
Domain Number 5 Region: 593-674
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000499
Family SH3-domain 0.0000284
Further Details:      
 
Domain Number 6 Region: 775-825
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000159
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000015550   Gene: ENSLAFG00000018550   Transcript: ENSLAFT00000018550
Sequence length 845
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_119:404515:487873:-1 gene:ENSLAFG00000018550 transcript:ENSLAFT00000018550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWRQCSHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLSPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNKGIMPFPTDEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRT
EPVAMPPRMTEYDKRCCCLREIQQTEEKYTDTLVSIQKHFMKPLQRFLKSQDIEIIFINI
EDLLVVHTLFLKEMKETLATPSAPNLYQVFIKYKERFLIYGRYCSQVESASKHLDRVASA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQDSMEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKM
DRYAFLLDKALLICKRRGDSYDLKDFVNLHNFQVRDDSSGERDNKKWSHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMYSFEETTSCAACQMLLRGTF
YQGYRCHRCRAPAHKECLGRVPMCGRHGQDFSGTMKKDKPHRRAQDKKRNDLGLPKMEVC
QEYYGIPPPPGAFGPFLRLNSGDIVELTKAEAEQNWWEGRNTATNEVGWFPCNRVKPYVH
GPPQDLSVHLWYAGPMERAGAENILTNRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKI
MTSEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPERRAISKPPAGS
IKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRIGWFPSNYVEED
YSEYC
Download sequence
Identical sequences G3TL13
ENSLAFP00000015550 ENSLAFP00000015550 XP_010599332.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]