SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000015761 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000015761
Domain Number 1 Region: 84-225
Classification Level Classification E-value
Superfamily C-type lectin-like 1.22e-34
Family C-type lectin domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000015761   Gene: ENSLAFG00000020818   Transcript: ENSLAFT00000020662
Sequence length 227
Comment pep:novel supercontig:loxAfr3:scaffold_193:441433:453174:-1 gene:ENSLAFG00000020818 transcript:ENSLAFT00000020662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNQTVTYSEVNLAKNPKRQQIKPKDADSSISVTEQEITYVELNLHGASQDLQKNDKNFC
CKDLPSPPGKFVAGILGIICIVLMASVVTVAVIVVTPLIHILFSAYHCGHCPGDWLSYSN
NCYYVSSDKKTWTESQMACASKKSNLIYIDNEEEMKFMDILSSYSWIGLSRESSDHSWLW
KNGSPLKQKIRETSNPMYNCAMLVSSDLQSASCGSETTYICKLEISS
Download sequence
Identical sequences G3TLI2
ENSLAFP00000015761 ENSLAFP00000015761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]