SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000017020 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000017020
Domain Number 1 Region: 350-490
Classification Level Classification E-value
Superfamily C-type lectin-like 5.57e-40
Family C-type lectin domain 0.00028
Further Details:      
 
Domain Number 2 Region: 932-1082
Classification Level Classification E-value
Superfamily C-type lectin-like 7.9e-39
Family C-type lectin domain 0.00053
Further Details:      
 
Domain Number 3 Region: 789-925
Classification Level Classification E-value
Superfamily C-type lectin-like 1.14e-38
Family C-type lectin domain 0.00028
Further Details:      
 
Domain Number 4 Region: 645-779
Classification Level Classification E-value
Superfamily C-type lectin-like 1.37e-38
Family C-type lectin domain 0.000000217
Further Details:      
 
Domain Number 5 Region: 22-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.64e-35
Family Cysteine rich domain 0.000000762
Further Details:      
 
Domain Number 6 Region: 1220-1358
Classification Level Classification E-value
Superfamily C-type lectin-like 7.52e-34
Family C-type lectin domain 0.00022
Further Details:      
 
Domain Number 7 Region: 223-346
Classification Level Classification E-value
Superfamily C-type lectin-like 2.53e-31
Family C-type lectin domain 0.00071
Further Details:      
 
Domain Number 8 Region: 499-638
Classification Level Classification E-value
Superfamily C-type lectin-like 3.21e-30
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 9 Region: 1088-1219
Classification Level Classification E-value
Superfamily C-type lectin-like 3.04e-29
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 10 Region: 153-211
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-20
Family Fibronectin type II module 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000017020   Gene: ENSLAFG00000022148   Transcript: ENSLAFT00000021691
Sequence length 1455
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_15:26716771:26822432:-1 gene:ENSLAFG00000022148 transcript:ENSLAFT00000021691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRLPVLLVFLSLVQVAVQLLDTRQFLIYNEDHKRCVEALSPSAVQTAACNPDNESQKFRW
VSDSQVMSVAFKLCLGVPSKTDWVAITLYACDSKNEFQKWECKNDTLFGIKGEDLFFNYG
NRQEKNIMLYKGSGLWSRWKIYGTTDDLCSRSYEAMFTLLGNANGATCAFPFKFENKWYA
DCTSVGRSDGWLWCGTTTDYDTDKLFGFCPLKFEGSESLWNKDPLTSIYYQINSKSALTW
HQARKSCQQQSAELLSITEIHEQTYLTGLTSSLTSGLWIGLNSLSFNSGWQWSEGSPFRY
LNWLPGSPSTEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNPFVIPSERDVPT
SCPSQWWPYAGHCYKIYRGEKKIQRNALTACRKEGGDLASIHSIEEFDFIFSQLGYESND
ELWIGLNDIKIQMYFEWSDGTPVTFTKWLHGEPSHENNRQEDCVVMKGKDGHWADRACEQ
PLDYICKMKAQTQVPAIVEVETGCRKGWKRHGFFCYLIGHTLSTFTEANQTCGNEKAYLT
TVEDRYEQAFLTSFVGLRPERYFWTGLSDIQSKGTFQWTIEEGVQFTHWNADMPGRKAGC
VAMRTGIAGGLWDVLKCDEKAKFVCKHWAEGATRPPEPTTTPEPKCPEDWGTTSKSSLCF
KLFTKGKHDKKTWFESRDFCRALGGDLASINNKEEQQAIWRLITSSSSYHELFWLGLTYG
SPSEGFTWSDGSPVSYEHWAYGEPNNYQNVEFCGELKGDPGMFWNDINCEHLNNWICQIK
KGQTPKPEPTPAPQDNPPVTEDGWVIYKEYQYYFSKEKETMDNAREFCKRNFGDLVSIQS
ESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFIWVDGSKVDYVAWATGEPNFANDDENCV
AMYSNSGFWNDINCGYPHAFICQRHNSSINATVLPTTPPVKGGCEQGWKSYNNKCFKIFG
FVEEERKNWQEARKACIGFGGNLVSIRNEKEQAFLTYQMTGSSFNAWIGLNDVNSEHTFL
WTDQRGVYYTNWGKGYPGGRRSSLSYEDADCVVIIGGKSQDAGKWMDDTCDSKRGYICHT
LPNPSLPVSPTTVPSDGFINFGESSYSLIDLKLSWYEAEKYCTLHNSHIGSILDPYSNAF
VWIQMEKLNSPVWIALNSNLTNNEYVWTDKWRVRYTNWAADEPKLKSACVYLDTDGYWKT
AYCNESFYSLCKRSNDTPATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTKNWGHASL
ECLRMGSSLVSIESAAESSFLSYRVEPLKSKTNFWIGLFRNVEGMWLWINKNPVSFVNWN
AGDPSGERNDCVTLLASSGFWNNVHCSSYKGYICKRPKIVDAEPTRTLMTTKADSRKMDP
SKPSSSVAGIVVIVILLILTGTGLAAYFFYKKRRVQLPQESTFENTLYFNSRSSPGTNDT
KDLMDNIEQNERAAI
Download sequence
Identical sequences G3TNX9
ENSLAFP00000017020 ENSLAFP00000017020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]