SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000017044 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000017044
Domain Number 1 Region: 613-855
Classification Level Classification E-value
Superfamily VPS9 domain 3.14e-49
Family VPS9 domain 0.00085
Further Details:      
 
Domain Number 2 Region: 44-143
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000000135
Family SH2 domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000017044   Gene: ENSLAFG00000022669   Transcript: ENSLAFT00000021795
Sequence length 976
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_9:69425164:69530924:1 gene:ENSLAFG00000022669 transcript:ENSLAFT00000021795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PISDVGKEEGKEEKEEDGVGLCLPATPKNCLPRRGISVLEKLIRTCPVWLQLGLGRAEVA
GILQQEAAGTFLVRKDGSLKHLVLCVHVPSRNEGSSEVLEYTIREERSILYLEGSVLVFE
DIFKLIAFYCVSRDLLPFTLRLPQAILEARSFTDLETISNLGLGKSSLRAKGTQQPPQSW
SPVLPFKSLLKATSHFSSCFCRFYLSIFMTCSFVLNPAFTDSHVCPATNPGHPKGSLGTT
PPCCPPLTLCSLVLALSPSLLVPSPPFVTFLTSHIPPQAKNKSLVPSVPTCLALEHSRLS
PLEAHRSPPETWPPGGCPQPPASGLQPITQTVPAKFVNPVFIEDCSGAQSTDPLQQALPR
TALKKRLCCTPQTSLSERTPLRNSARGRQTAEGDQLGTSRATSLSLPLQGTSDSPGDRPL
RTTEQDQEAEAKASGPGSVQEPPKKTKQPPVPPPRKKRISRQLASALLSPFECPERSMEE
VAPEKPPSGPPKEGPSPAPQVGTLSLHAQAGAHPQSSAEFTGSLASLSESLGVPTLATDQ
DSYSTSSTEEELEQFCSPSGKKKPSMILGKARHRLSLASFTNVFHAFLSNNRKLYKKVVE
LAQDKASYFGSLVQDYKVYSLEMMAHQASSTEMLQEIRTMMTQLKSYLLQSIELKALVDP
TLHLEEELEAIVESALYKCVLKPLKEAINSCLHEIHSKDGSLQQLKENQLVVLATTTTDL
GVTTSVPEVPMMEKILQKFSSMHKAYSPEKKIAILLKTCKLIYDSMALGNPGKPYGADDF
LPVLMYVLARSNLTEMLLDVEYMMELMDPALQLGEGSYYLTTTYGALEHIKNYDKITVTR
QLSVEVQDSIHRWERRRTLNKARASRSSVQDFICVSYLEPEQQSRTLASRADTPAQALCE
QCAEKFEVAQPQDHRLFVLVDGRCFQLADEALPHRIKGYLLRSEPKRDFHFVYRPLDGGG
GSGSPPCLVVREPNFL
Download sequence
Identical sequences G3TNZ6
ENSLAFP00000017044 ENSLAFP00000017044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]