SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000017760 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000017760
Domain Number 1 Region: 896-1023,1219-1363
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.88e-47
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 2 Region: 496-583
Classification Level Classification E-value
Superfamily E set domains 1.4e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.092
Further Details:      
 
Domain Number 3 Region: 402-496
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000177
Family Other IPT/TIG domains 0.0068
Further Details:      
 
Domain Number 4 Region: 581-685
Classification Level Classification E-value
Superfamily E set domains 0.000000000000012
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.055
Further Details:      
 
Domain Number 5 Region: 54-106
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000576
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 6 Region: 10-57
Classification Level Classification E-value
Superfamily Sema domain 0.00000000116
Family Sema domain 0.014
Further Details:      
 
Domain Number 7 Region: 682-771
Classification Level Classification E-value
Superfamily E set domains 0.000000784
Family E-set domains of sugar-utilizing enzymes 0.071
Further Details:      
 
Domain Number 8 Region: 353-386
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000549
Family Plexin repeat 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000017760
Domain Number - Region: 198-230
Classification Level Classification E-value
Superfamily Plexin repeat 0.017
Family Plexin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000017760   Gene: ENSLAFG00000020958   Transcript: ENSLAFT00000021673
Sequence length 1438
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_101:3014056:3203586:1 gene:ENSLAFG00000020958 transcript:ENSLAFT00000021673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIRVDGPSGKAHQYETVQVVDPGPVLRDMAFSKDHEQLYIMSERQLTRVPVESCSQYRSC
SECLGSGDPHCGWCVLHNTCTRKERCERSREPRRFASEMKQCVRLTVHPNNISVSQYNVL
LVLETYNVPELSAGVNCTFEDLSEMDGLVVGNQIQCYSPAAGEVPRIITENGDHHVVQLQ
LKSKETGMTFASTSFVFYNCSVHNSCLSCVKSPYRCHWCKYRHVCTHDPKTCSFQEGRVK
LPEDCPQLLRVDKILVPVEVIKPITLKAKNLPQPQSGQRGYECILSVQGSEQRVPALRFN
SSSVQCQNTSYSYEGMEINNLPVELTVVWNGHFSIDNPAQNKVHLYKCGAMRESCGLCLK
ADPDFQCGWCQGQAQCTLRQHCPAHESQWLELSGANSKCTNPRITEIIPVTGPREGGTKV
TIRGENLGLEFRDIASHVKVAGVECNPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAV
CRPEFMARSSQLYYFMTLTLSDLKPSRGPMSGGTQVTITGTNLNAGSNVVVMFGKQPCLF
HRRSPSYIVCNTTSSEEVLEMKVMVQVDRARIHQDLFFQYVEDPTIVRIEPEWSIVSGNT
PIAVWGTHLDLIQNPQIRAKHGGKEHINICEVLNATEMTCQAPALAVGPDHQSDLTERPE
EFGFILDNVQSLLILNKTNFTYYPNPVFEAFGPSGILELKPGTPIILKGRNLIPPVAGGN
VKLNYTVLVGEKPCTVTVSDVQLLCESPNLIGRHKVMARVGGMEYSPGMVYIAPDSPLSL
PAIVSIAVAGGLLVIFIVAVLIAYKRKSRESDLTLKRLQMQMDNLESRVALECKEAFAEL
QTDIHELTSDLDGAGIPFLDYRTYTMRVLFPGIEDHPVLRDLEAPGYRQERVEKGLKLFA
QLINNKVFLLSFIRTLESQRSFSMRDRGNVASLIMTVLQSKLEYATDVLKQLLADLIDKN
LESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDA
ITGEARYSLSEDKLIRQQIDYKTLVLSCVNPDNANSPEVPVKILNCDTITQVKEKILDAI
FKNVPCSHRPKAADMDLEWRQGSGARMILQDEDITTKIENDWKRLNTLAHYQVPDGSVVA
LVSKQVTAYNAVNNSTVSRTSASKYENMIRYTGSPDSLRSRTPMITPDLESGVKMWHLVK
NHEHGDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYM
FDFLDEQADKHGIHDPHVRHTWKSNCLPLRFWVNMIKNPQFVFDIHKNSITDACLSVVAQ
TFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKSWVERVFDSPTQESVIAPHQGLCYRSQV
TPVHLVIFRSGLMVSISYPTTGEQQEQILGPLDHDDQCGKQKLAYKLEQVITFMSLDS
Download sequence
Identical sequences G3TQE4
ENSLAFP00000017760 ENSLAFP00000002481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]