SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000018108 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000018108
Domain Number 1 Region: 42-455
Classification Level Classification E-value
Superfamily Sema domain 1.96e-97
Family Sema domain 0.00012
Further Details:      
 
Domain Number 2 Region: 1299-1425,1620-1808
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-46
Family p120GAP domain-like 0.022
Further Details:      
 
Domain Number 3 Region: 901-989
Classification Level Classification E-value
Superfamily E set domains 5.86e-16
Family Other IPT/TIG domains 0.033
Further Details:      
 
Domain Number 4 Region: 988-1092
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000891
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.067
Further Details:      
 
Domain Number 5 Region: 804-903
Classification Level Classification E-value
Superfamily E set domains 0.000000000000014
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 6 Region: 458-510
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000157
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 7 Region: 1089-1179
Classification Level Classification E-value
Superfamily E set domains 0.000000294
Family E-set domains of sugar-utilizing enzymes 0.053
Further Details:      
 
Domain Number 8 Region: 757-790
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000222
Family Plexin repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000018108   Gene: ENSLAFG00000030064   Transcript: ENSLAFT00000029643
Sequence length 1838
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_12:28109460:28157034:1 gene:ENSLAFG00000030064 transcript:ENSLAFT00000029643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLSPLVLLVLLLLLPSLPLRGVWVEAGTPRAAGGLQPAFRTFAASEWGLTHLVVHEQTGE
VYVGAVNRIYKLSGNLTLLRAHVTGPVEDNEKCYPPPSVQSCPHGLGSTDNVNKLLLLDY
AANRLLACGSASQGICQFLRLDDLFKLGEPHHRKEHYLSSVREAGSMAGVLIAGPPGQGQ
AKLFVCTPIDGKSEYFTTQFVYYLTLQLDTQLTSPDVGEHFFTSKIVRLCVDDPKFYSYV
EFPIGCEQAGVYRLVQDAYLSRPGRALAHQLGLAEDEDVLFTVFAQGQKNRVKPPKESVL
CLFTLRAIKERIKERIQSCYRGEGKLSLPWLLNKELGCINSVTQGEDDVAGACLSRHLQG
RVACWGLPSFWDKSCGERHVVIYHWSGKLSTEAGLGSGSARPILVDLASPSGRPALAYES
VVAQEGSPILRDLVLSPNRQYLYAMTEKQVTRVPVESCVQYTSCELCLGSRDPHCGWCVL
HSICSRQDACERADEPQRFASDLLQCVQLTVQPRNVSVTMSQVPLVLQAWNVPDLSAGVN
CSFEDFTESESVLEDGRIHCLSPSAREVAPITRGQGDQRVVKLYLKSKETGKKFASVDFV
FYNCSVHQSCLSCVNGSFPCHWCKYRHVCTHNAADCAFLEGRVNVSEDCPQILPSTQIYV
PVGVVKPITLAARNLPQPQSGQRGYECLFHIPGSPARVTALRFNSSSLQCQNSSYFYEGN
DISALPVNLSVVWNGNFVIDNPQNIQAHLYKCPALRESCGLCLKADPRFECGWCVAERRC
SLRHHCPADTPGSWMHARHGSSRCTDPKILKLSPETGPRQGGTRLTITGENLGLKFEDVR
LGVRVGKVLCSPVESEYVSAEQIVCEIGDASLVRGHDALVEVCVRDCSPHYRALSPKRFT
FVTPTFYRVSPARGPLSGGTWIGIEGSHLNAGSDVAVSVGGRPCSFSWRNSREIRCLTPP
GQSPGSAPIVININRAQLTNPEVQYNYTEDPTVLRIDPEWSINSGGTLLTVTGTNLATVR
EPRIRAKYGGVERENSCTVYNDTTMVCLAPSIDNPLRTPPELGERPEELGFVMDNVRALL
VLNASAFVYYPDPVLEPLSPTGLLELKPSSPLILKGRNLLPPAPGNLRLNYTVLIGSTPC
ALTVSETQLLCESPNLTGQHKVTVRAGGFEFSPGVLQVYSDSLLTLPAIVGIGGGGGLLL
LVIVAVLIAYKRKSRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTSDLDGS
GIPFLDYRTYAMRVLFPGIEDHPVLKEMEVQANVEKSLTLFGQLLTKKHFLLTFIRTLEA
QRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRREPPAT
ALQVSWGLVCGGYYFCPECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQ
IDYKTLTLNCVNPENENAPEVPVKGLNCDTVTQVKEKLLDAVYKGVPYSQRPKAGDMDLE
GRQGPMGRIILEDKDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQTSAYNISNSSTFT
KSLSRYESMLRTASSPDSLRSRTPMITPDLESGTKLWHLVKNHDHLDQREGDRGSKMVSE
IYLTRLLATKGTLQKFVDDLFETIFSTAHGSALPLAIKYMFDFLDEQADKHQIHDADVRH
TWKSNCLPLRFWVNVIKNPQFVFDIHKSSITDACLSVVAQTFMDSCSTSEHKLGKDSPSN
KLLYAKDIPNYKSWVERYYADIAKMPAISDQDMSAYLAEQSRLHLSQFNSMSALHEIYSY
ITKYKDEILVALEKDEQARRQRLRSKLEQVVDTMSLSS
Download sequence
Identical sequences G3TRA0
ENSLAFP00000018108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]