SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000018145 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000018145
Domain Number 1 Region: 43-181
Classification Level Classification E-value
Superfamily PH domain-like 2.74e-22
Family Pleckstrin-homology domain (PH domain) 0.0085
Further Details:      
 
Domain Number 2 Region: 346-445
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-16
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 3 Region: 919-1064
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000222
Family Tropomyosin 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000018145
Domain Number - Region: 690-755
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0128
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000018145   Gene: ENSLAFG00000028265   Transcript: ENSLAFT00000035752
Sequence length 2270
Comment pep:novel supercontig:loxAfr3:scaffold_96:1470207:1674468:1 gene:ENSLAFG00000028265 transcript:ENSLAFT00000035752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAKENPCRKFQANIFNKSKCQNCFKPRESHLLNDEDLSQAKPIYGGWLLLAPDGTDFD
NPVHRSRKWQRRFFILYEHGLLRYALDEMPTTLPQGTINMNQCTDVVDGEGRTGQKFSLC
ILTPEKEHFIRAENKEIISGWLEMLMVYPRTNKQNQKKKRKVEPPTPQEPGPAKMAVTSS
SSIPSAEKVPTTKSTLWQEEMRAKDQPDGRSLSPAPSPGQSQPSAASTLREPGLEGREEE
GTMSSEQMDCGRKVRVESGYFSLEKTKQDLKAEEQQLPPPLSPPSPSTPSNRRSQVIEKF
EALDIEKAEHMETSAPAGPTSASDTRQGRSEKRVFPRKRPDLLNFKKGWLTKQYEDGQWK
KHWFVLADQSLRYYRDSVAEEAADLDGEIDLATCYNVTEYPVQRNYGFQIHRQQGHFSSR
AAETAALKPSWVQSLENDVTPTASRPDTIQSSLPEEKSKSSSPETCPRPSEKQESDTGEP
DPDQRRSRARERRREGRSKTFDWAEFRPIQQALAQERASATGPCDAREPGCPEADPGELE
RERTRRREERRRRFGALDTVDGPGGTDDAILRMEVDRSPGLPVTPDLKTQSVHVEIEQRW
HQVETTPLREEKQVPISPLHLASSEDGSDRLPAQELTSLLEKELEQSQKEASELLEQNRL
LQDQLRVALGREQSAREGYVLQTEVAACPPGAWQRLHKVNQDLQSELEAQCQRQELVNQQ
IQALKRSYGEAKDAIRHHEAEAQSLQARLSNAAAELAIKEQALAKLKSDLKLEKDKVREQ
LEEWQHSEAVLSGQLKASEQKLKSAEALLLEKMQELRDLETQQALQRDRQREVQRLQERV
ADLSQQLGASEQAQRLMEEKLQKNYELLLESCEKEKQVLLKSLKEVEDKSAYEDELNREQ
QVEVLQKEKLSAKFEGSEHVHQLEEQLEKKEASIQELSEHVQGLRDECDLLRQRFQELVA
RVTVSDGDVAALQAQLRGRESDYQSLERSFGEVSGQLQCMHALLHEREEELGRIKDLHER
VVEKKEQDLSEALVKMVALGSSLEETEIKLQAKEEMLRKLADEPSKESEEPHTTLGTDSG
GIMHVGQQLQATGVPLGIPHIGPKGKDPGTDLGEDNGVSSPGGEDSTVPLRSPEAPDDEG
HLESMTRPDPGIPGVKRQKIRFSTIQCQKYIHLDGSEKAWTSSASSDTSQDRSLSEESMS
SEPAPGPLPGPSDTDTYLSIIHSLETKLYITEEKLKDVTLRLESQRGRDQEALVALHHQW
AGTEAQLREQLRASLTQASALASQLELERQGRAAFTESHAGELGDFQVKNSQALTCLEKC
LEQLRSLPRMGPEEEHAAPAACLASMEGILAEAIQVLQLVPAPTDNTAPALHEDGSCLQG
RRPPAQQPELTEQEQLKRLSDQIALEASLISQIADSLRNTTSDISCILQEISQVGGLPLE
SENATACPGPLADSLAKKLLVDGEFWSQVELLSQHLVTLGGEAVDATDGGWLGLAPALAP
TVADATLVRAELSFVTQSVRESFHHRLSTVQDNLCSTRAALQRLRCTLSQILEAYHTPDF
DRVMQQASGALGLQAGVEEGVLQSWDLSLVGEVPRQDPSSALEPFQLSGRRSSTLIAVQE
ELAQQLKAKARTLGEIATALACLPPAESISSCQKLLQASQTLSYSSCLGGLGQYSSLLVQ
DAIIQAQVCYAACRIRLEYEKELQLYKDSWQSRDAPCQRHVQALGALREEYEDLLRKQKS
EYLEVIAIIERENAELMARVTELGHQQGCLEAVESRHSATVRTLQGRHREELLGVVEQLG
QAERTLQAEHSRVLSQLDTSARDRQDLEQHHVEQMQTLEDRFQLKIKELQGIHAEELRTL
QEHCSQNLQRLKETLSHCQQQRPGALPAPGPPSGLPPPSPSWPATESAARLHERIQELEA
QTDAMREELEHKDLEGGAATLRKKYQRDLENLKATCERGFAAMEETHQKKIEDLQRQHQR
ELEKLREEKDRLLAEETAATISAIEAMKNAHREEMERELEKSQRSQISSINSDIEALRRQ
YLEELQSVQRELEVLSEQYSQKCLENAHLAQALEAERQALRQCQRENQELNAHNQELNNR
LAAEITRLRTLLTGDGGGEAGGSPLTQGKDAYELEVLLRVKESEIQYLKQEISSLKDELQ
TALRDKKYASDKYKDIYTELSIVKAKADCDISRLKEQLKAATEALGEKSPENTTVSGYDI
MKSKSNPDFLKKDRSCVSRQLRNIRSKSLKEGLTVQERLKLFESRDLKKD
Download sequence
Identical sequences G3TRD7
ENSLAFP00000018145 ENSLAFP00000018145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]