SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000018402 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000018402
Domain Number 1 Region: 898-1021,1216-1405
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.42e-45
Family p120GAP domain-like 0.028
Further Details:      
 
Domain Number 2 Region: 500-588
Classification Level Classification E-value
Superfamily E set domains 4.33e-16
Family Other IPT/TIG domains 0.033
Further Details:      
 
Domain Number 3 Region: 587-691
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000051
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.067
Further Details:      
 
Domain Number 4 Region: 403-501
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000177
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 5 Region: 57-109
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000118
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 12-60
Classification Level Classification E-value
Superfamily Sema domain 0.000000122
Family Sema domain 0.02
Further Details:      
 
Domain Number 7 Region: 688-778
Classification Level Classification E-value
Superfamily E set domains 0.000000224
Family E-set domains of sugar-utilizing enzymes 0.053
Further Details:      
 
Domain Number 8 Region: 356-389
Classification Level Classification E-value
Superfamily Plexin repeat 0.000017
Family Plexin repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000018402   Gene: ENSLAFG00000030064   Transcript: ENSLAFT00000032816
Sequence length 1435
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_12:28123332:28157031:1 gene:ENSLAFG00000030064 transcript:ENSLAFT00000032816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QILVDLASPSGRPALAYESVVAQEGSPILRDLVLSPNRQYLYAMTEKQVTRVPVESCVQY
TSCELCLGSRDPHCGWCVLHSICSRQDACERADEPQRFASDLLQCVQLTVQPRNVSVTMS
QVPLVLQAWNVPDLSAGVNCSFEDFTESESVLEDGRIHCLSPSAREVAPITRGQGDQRVV
KLYLKSKETGKKFASVDFVFYNCSVHQSCLSCVNGSFPCHWCKYRHVCTHNAADCAFLEG
RVNVSEDCPQILPSTQIYVPVGVVKPITLAARNLPQPQSGQRGYECLFHIPGSPARVTAL
RFNSSSLQCQNSSYFYEGNDISALPVNLSVVWNGNFVIDNPQNIQAHLYKCPALRESCGL
CLKADPRFECGWCVAERRCSLRHHCPADTPGSWMHARHGSSRCTDPKILKLSPETGPRQG
GTRLTITGENLGLKFEDVRLGVRVGKVLCSPVESEYVSAEQIVCEIGDASLVRGHDALVE
VCVRDCSPHYRALSPKRFTFVTPTFYRVSPARGPLSGGTWIGIEGSHLNAGSDVAVSVGG
RPCSFSWRNSREIRCLTPPGQSPGSAPIVININRAQLTNPEVQYNYTEDPTVLRIDPEWS
INSGGTLLTVTGTNLATVREPRIRAKYGGVERENSCTVYNDTTMVCLAPSIDNPLRTPPE
LGERPEELGFVMDNVRALLVLNASAFVYYPDPVLEPLSPTGLLELKPSSPLILKGRNLLP
PAPGNLRLNYTVLIGSTPCALTVSETQLLCESPNLTGQHKVTVRAGGFEFSPGVLQVYSD
SLLTLPAIVGIGGGGGLLLLVIVAVLIAYKRKSRDADRTLKRLQLQMDNLESRVALECKE
AFAELQTDIHELTSDLDGSGIPFLDYRTYAMRVLFPGIEDHPVLKEMEVQANVEKSLTLF
GQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIEK
NLESKNHPKLLLRREPPATALQVSWPDSRPASQECAGEPLFMLYCAIKQQMEKGPIDAIT
GEARYSLSEDKLIRQQIDYKTLTLNCVNPENENAPEVPVKGLNCDTVTQVKEKLLDAVYK
GVPYSQRPKAGDMDLEGRQGPMGRIILEDKDVTTKIDNDWKRLNTLAHYQVTDGSSVALV
PKQTSAYNISNSSTFTKSLSRYESMLRTASSPDSLRSRTPMITPDLESGTKLWHLVKNHD
HLDQREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDF
LDEQADKHQIHDADVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKSSITDACLSVVAQTFM
DSCSTSEHKLGKDSPSNKLLYAKDIPNYKSWVERYYADIAKMPAISDQDMSAYLAEQSRL
HLSQFNSMSALHEIYSYITKYKDEILVALEKDEQARRQRLRSKLEQVVDTMSLSS
Download sequence
Identical sequences G3TS44
ENSLAFP00000018402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]