SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000019000 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000019000
Domain Number 1 Region: 163-200
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000126
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 2 Region: 124-161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000406
Family LDL receptor-like module 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000019000
Domain Number - Region: 75-122
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000749
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number - Region: 34-77
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.009
Family Spermadhesin, CUB domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000019000   Gene: ENSLAFG00000027575   Transcript: ENSLAFT00000029462
Sequence length 302
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_43:9602366:9603943:-1 gene:ENSLAFG00000027575 transcript:ENSLAFT00000029462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPRRVLLQAEAATYDDYVQYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARA
RSAGHGFNATYQVKGYCLPWEQPCGSSSEGDVGDAGDQGCFSEPQRCDGWWHCASGRDEQ
GCPACPPDQYPCEGGSGLCYTLADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFET
WRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYR
AFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQILRTAMRRQMR
RH
Download sequence
Identical sequences G3TTU2
ENSLAFP00000019000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]