SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000019341 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000019341
Domain Number 1 Region: 881-1173
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 5.58e-87
Family Complement components 0.0000115
Further Details:      
 
Domain Number 2 Region: 1254-1382
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 6.15e-32
Family Alpha-macroglobulin receptor domain 0.0011
Further Details:      
 
Domain Number 3 Region: 717-770
Classification Level Classification E-value
Superfamily E set domains 0.0000000014
Family SVA-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000019341   Gene: ENSLAFG00000006753   Transcript: ENSLAFT00000026032
Sequence length 1420
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_0:92035379:92194587:-1 gene:ENSLAFG00000006753 transcript:ENSLAFT00000026032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRFLVTAPGIIRPGGNVTIGVELLEHSPSQVTVKAEVLKMASNVTTPVLEAEGVFEKGSF
KTLVLPSLPLNSVNEIYELRVTGRAEDEILFSNTTLLSFETKRMSVFIQTDKPLYKPKEE
VKFRVLTLFSDFKPYKTSLSIVIKDPKSNLIQQWLSEQNNLGVVSKTFQLSSHPILGDWS
IQVQVNDQTYYQSFQVSEYVLPKFEVTLQTPLYCSLNSKSLNGTVVAKYTYGKPVKGDVT
LTFLPLSFWGVKKNITKNFKINGSANFSFNEEEMKKVMDFSDGLYEHMDLSSPGPVEILA
TVTESLTGISRNASSNVFFKQHDYIIEFFDYVTVLKPSLNFTATVKVTRSDGNQLTLEER
RNDVVITVTQRNYTDYRSRWNSRSQEMGAVQIMNFTVPQNGIFKVEFPILDDTSELQLKG
YFIDSVSSMEVHGMFKSPSKTYIQLKARNENIKVGSPFQLVVSGNKQFKELSYMVVSRGQ
LVAVGKQNSATFSLTPENSWAPRACIIVFYIEDDGEIINDVLKIPVQLAFKNKINLFWSK
ANAEPSEKVSLMISVTQPDSLVGIVAVDKSVNLMNASNDITMENVAHELELYNTGYYLGM
FVNSFAVFQECGLWVLTDANLVKDYIDGVYDNPEVAERFVEESEGYMVDFHDFSSVSNPR
VRKHFPETWIWLDANMGSKIYQEFEVTVPDTITSWAATAFVISEDLGLGLTTAPVELRAF
QPFFIFLNLPYSVIRGEEFALEVTIFNYLKDATEVKVIIEESDKFDILVTSNEVNATGYQ
QTILVPSEDGATLLFPVRPTHLGEIPITVTAVSPTASDALTQKILVKAEGIEKSYSQSIL
LDLTDNKLRNTLKTLSFSFPPETVSGSERVQITAIGDILGPSIKGLASLIRMPYGCGEQN
MINFAPNIYVLDYLTKKKQLTDNLREKALSFMRQGYQRELLYQREDGSFSAFGNDDPSGS
TWLSAFVLKCFLEADPYIDVDPNVLQRTYTWLQGRQKSNGEFWEPGRVIHSELQGGNKSP
VTLTAYIVTSLLGYKKYQPNIDVQESINFLESEFNRGISDNYTLALITYALSSVRSPKAQ
EALNMLTQRAEQEGGMQFWVSSVSKLSESWQPSSLDIEVAAYALLSHFLQFRVPEGIAIM
RWLSRQRNSLGGFASTQDTIVALKALSEFAALMNTESTDIQVTVMGPTSPNPVKFLIDTQ
NRFLLQSVELPVVQPTTVNISANGFGFAICQLNVIYNVKNSESSRRRRSLQNEEAFDLDV
AVNDDEDDINHLNLSVCTRYLGPARSGMALMEVTLLSGFAVPLDAIPRSEIIKKVEHDHG
TVNLYLDSVNETQVCVDIPAVRNFKVSNTQDASVSIVDYYEPRRRAVRTYNSKAKLSSCD
LCGHVHGCHLCEKGAASSLHHSSVILVFCFMLLFSLQRWL
Download sequence
Identical sequences G3TUT3
ENSLAFP00000019341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]