SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000019375 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000019375
Domain Number 1 Region: 1044-1138
Classification Level Classification E-value
Superfamily Immunoglobulin 1.07e-24
Family I set domains 0.0028
Further Details:      
 
Domain Number 2 Region: 756-849
Classification Level Classification E-value
Superfamily Immunoglobulin 5.56e-22
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 852-946
Classification Level Classification E-value
Superfamily Immunoglobulin 6.25e-21
Family I set domains 0.0078
Further Details:      
 
Domain Number 4 Region: 1140-1227
Classification Level Classification E-value
Superfamily Immunoglobulin 8.83e-20
Family I set domains 0.0063
Further Details:      
 
Domain Number 5 Region: 948-1042
Classification Level Classification E-value
Superfamily Immunoglobulin 3.35e-19
Family I set domains 0.0051
Further Details:      
 
Domain Number 6 Region: 118-212
Classification Level Classification E-value
Superfamily Immunoglobulin 8.83e-18
Family I set domains 0.0093
Further Details:      
 
Domain Number 7 Region: 310-403
Classification Level Classification E-value
Superfamily Immunoglobulin 2.69e-16
Family I set domains 0.0098
Further Details:      
 
Domain Number 8 Region: 663-753
Classification Level Classification E-value
Superfamily Immunoglobulin 4.35e-16
Family I set domains 0.0039
Further Details:      
 
Domain Number 9 Region: 213-306
Classification Level Classification E-value
Superfamily Immunoglobulin 8.01e-16
Family I set domains 0.0099
Further Details:      
 
Domain Number 10 Region: 402-485
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000142
Family I set domains 0.017
Further Details:      
 
Domain Number 11 Region: 25-114
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000436
Family I set domains 0.009
Further Details:      
 
Domain Number 12 Region: 569-660
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000543
Family I set domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000019375   Gene: ENSLAFG00000011426   Transcript: ENSLAFT00000031343
Sequence length 1316
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_100:977212:990207:-1 gene:ENSLAFG00000011426 transcript:ENSLAFT00000031343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQTFTLLLFCMCEYKGGEMTVMESQPELWIETNYPQAPWENITLWCRSPSQISSQFLLL
KDKTQMTWVQPTYKTFQVSFPIGALNESNTGLYRCCYWQETGWSKPSKILELEAPGQLPK
PIFWILAESSTLPGCNVNVFCHGWLQDLVYLLFKEGYAEPVDYQVPTGTVAIFSIDNMTP
ENEGVYICRTHIQILPTLWSEPSNPLKLIIAGLYPKPTLTAYPGLILAPGESLNLRCQGP
IYGMTFALMRLEDLEKSFHHKRPTKNEAYFSFRALKINDAGHYLCFYYDGSYRGSLLSDI
LKIWVTETLPPKPWLLAQPSPVVQMGQNVSLCCQGPVDGVGLTLYKREDKPLQLLDATNI
DGDDSFFLNNVTYSDAGIYSCHYLLTWKSSIRMIAYNTMELVVVAWPSTMFKLGKTITLQ
CRVPHLVLEFSLEREDGATSQKFSVDGDFIISNVEGKGAGTYSCSYRVEAHPDIWSHRSE
PLKLMGPAGSLTWNYVLNEAIRLSLITQFVALLSVVLWIRWKCRRLRIREAWLLRTAQGV
TMLFIVTALLCCGEYKGVALLFLEIIMPTPKPELWAETNFPLAPWKNLTLWCRSPSSSTK
EFVLLKDGTGWIATRPASELVRAAFPLGALTQSHIGSYHCHSWEEMAVSEPSEALELVGT
DILPKPVISASPPIRGQELQIQCKGWLAGMGFALYKEGEQEPVQQLGAVGKEAFFTIQRM
EDKDEGNYSCRTHTEKRPFKWSEPSEPLELVIKEMYPKPFFKTWASPVVTLGAQVTFNCS
TPQQHMSFILYKDGSEIASSDGSWASPGASAAHFLLVSVGTGDGGNYTCRYYDFAVWSEP
SDPVELVVTEFYPKPTLLAQPGPVVLPGKNVTLHCQGAFQGMRFALLQEGTQDPLQFQSA
SGNSADFILHTVGAEDSGNYSCVYYETTMSNRGSHLSMPIMIWVTDTFPKPWLYAEPSSV
IPLGQNVTLWCQGPVHEVGYILHKEGEATSMQLWGSSSDDGAFLITNISGASIGRYSCCY
HPDWTSPIKIQPSNTLELIVTGLLPKPSLLAQPGPMVAPGENITLQCQGELPDSTFVLVK
EGAQQPLEQQRPSGYRADFWMPAVRGEDSGIYSCVYYLDSAPFVASNHSDPLEIWVTDKP
PKPSLSAWPSTVFKLGKDITLQCRGPLPGVEFVLEHDGEEAPQQFSEIGDFVINNVEGKG
IGNYSCSYRLQANPDIWSEPSDPLELVGAAGPVAQECTVGNIVRSTLIVVVVVALGVVLA
IEWKKWPRLRTRGSDTDGRDQSIALEECNQEIELGTTTNSPSSISQGTSEELPVPI
Download sequence
Identical sequences G3TUW7
ENSLAFP00000019375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]