SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000019465 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000019465
Domain Number 1 Region: 198-300
Classification Level Classification E-value
Superfamily SRCR-like 8.89e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000899
Further Details:      
 
Domain Number 2 Region: 66-173
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 3 Region: 486-587
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00017
Further Details:      
 
Domain Number 4 Region: 361-457
Classification Level Classification E-value
Superfamily SRCR-like 1.03e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000019465   Gene: ENSLAFG00000012462   Transcript: ENSLAFT00000029897
Sequence length 590
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_45:1721918:1730838:1 gene:ENSLAFG00000012462 transcript:ENSLAFT00000029897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPSERPSTGWTHKETEMRIGPQPVEKSRGWRPGDGSTAPSPLPPALSFFLLLPLASALQ
PTPLPFPELRLVGGPSRCRGRLEVLHSGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPR
PLAFGQGWGPILLDNVECHGQEAALSECGSRGWGVHNCFHYEDVAVLCDEFLPTQPPIRK
MLTSRAVPTASQNGKGEGSVRLVGGTGPCQGRVEILHGGLWGTVCDDDWGLPDAAVVCRQ
LGCGTALAATTNAFFGYGTGHIMLDNVHCEGSEPRLAACQSLGWGVHNCGHHEDAGALCA
VLGPPTLAVPLPSATREDWAGHTEPLATGAGAQPSRETALLTSAWAAGKKRGGKRGAGAL
GASSPSGRGEVLYAGGWGTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPVLL
DNVGCAGTEAHLNDCFHLGWGQHNCGHHEDAGALCVAEPGPEELGLQVQQDGSETTQVPT
PRPRDGHLRLSSGAHRCEGRVELFLGQRWGTVCDDAWDLRAAGVLCRQLGCGEALAAPGE
AHFGPGRGPILLDNVKCRGDESILLLCSHIRWDAHNCDHSEDASVLCRLS
Download sequence
Identical sequences G3TV57
ENSLAFP00000019465 ENSLAFP00000010411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]