SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000020089 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000020089
Domain Number 1 Region: 1308-1368
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000249
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 2 Region: 990-1166
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000000942
Family RUN domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000020089   Gene: ENSLAFG00000002455   Transcript: ENSLAFT00000031834
Sequence length 1378
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_6:64748056:64760418:-1 gene:ENSLAFG00000002455 transcript:ENSLAFT00000031834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSPPKLTGETLIVHHIPLVHCQVPDRQCCVGASGGGGSTRPNPFCPSELGITQPDQDLV
QADSLLYNSLHSAPGGLARSTDSTKSRGRDGRGSGAPKRRNPFLLQEGVGEPGLGDLYDD
SIGDSTTQQSFHLHGVGQPPFHLSSFQLPPTGPGVGRPWGTTRSRAGVVEGQEQEPVTTL
DTQHCSIRHCCRPELEAETMELDECGGPGGSGGGASDTSGFSFDQEWKLSSDESPRNPRC
SGSVRQHCRCSSTSSQSEAADQSMGYVSDSSCNSSDGVLVTFSTLYNKMHGNSRANLNSA
PQTYSDSSFCSHSDPGTFYLDLQPSPAESKMSCESHLPDSGGREGGYGCPHASSPELDAN
CNSYHPHCEPCPAMADLTACFQSQARLVVATQNYYKLVTCDLSSQSSPSPAGSSVTSCSE
EPTKISPTPGPGPEPGPSQPSEYYLFQKPEIQPEEQEALGSSAEAVAAVGPTVMEGQVYT
NTSPPNLSTGRQRSRSYDRSLERSPPVRLGSLERMLSCPVRLSEGPAALAGPSSLPKRVT
SFAELAKGRKKAAGSGSPPLRVSVGDSSQEFSPIQEAQQDRVGPPDEGTRCSHSLPPIPL
GPSVDLVGPESWSTQVCQGPQSSEMPPAGLRAAGQDPVAQLMDPGPALPGTPTNSHTQRD
ARARADGKFPKSQDVLHSDPLLFPDLIPLPQSLFWEFSRKSVDSGCSETSLSQRYSASSC
SFGYQHLPRWLPHCSSPAPAPSGEPLGSTSRTTDRGAKKAGPEPETSRPSPLGSYSPIRS
AGPFGPSTDSSASTSCSPPPEQATAIESPPLWSHSCPPAARPATFQQPQKEDQKILTLAE
YRLHGTGSLPPLGSWRSGLSRAESLTRGGSEGSMASRPSNANHLSPQALKWREYRRKNPL
GPPGLAGSLDRRPQEARLSRRNPIFEFPGSLSAASHLNCRLNGQVVKPLPLTCPDFQDAF
SLTEKPPAEFCLSPDGNSEAISIDLLQKKGLVKAVNTAVDLIVAHFGTSRDPGVKAKLGN
SSVSPNVGHLVLKYLCPAVRAVLEDGLKAFVLDVIIGQRKNMPWSVVEASTQLGPSTKVL
HGLCNKVSQFPELTSHTMRFNAFILGLLNIRSLEFWFNHLYNHEDIIQTHYQPWGFLSAA
HTVCPGLFEELLLLLQPLALLPFNLDLLFQHRLLQSGQQQRQHKELLRVSQDLLLSAHST
LQLARARGQEGPGDLDRTAHGERVKGVGAPEGGEEEEETEEVAEAAQGSGQGRWARGGQA
GWWYQLMQSSQVYIDGSTEGSRFPRGEKKKGAGGGGFGFRWGFLTSVCYFPSEVQALCHH
LATGPGQLSFHKGDILRVLGPAKGDWLRCSRGPDTGLVPLAYVTLTPTPSPTPGSSQN
Download sequence
Identical sequences G3TWY1
ENSLAFP00000002052 ENSLAFP00000020089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]