SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000020322 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000020322
Domain Number 1 Region: 42-231
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.89e-65
Family Regulator of G-protein signaling, RGS 0.0000000225
Further Details:      
 
Domain Number 2 Region: 454-682
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-61
Family DBL homology domain (DH-domain) 0.000000548
Further Details:      
 
Domain Number 3 Region: 683-817
Classification Level Classification E-value
Superfamily PH domain-like 6.47e-39
Family Pleckstrin-homology domain (PH domain) 0.0000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000020322   Gene: ENSLAFG00000009353   Transcript: ENSLAFT00000036508
Sequence length 977
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_283:137160:152721:1 gene:ENSLAFG00000009353 transcript:ENSLAFT00000036508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEMARGAAPGPPRPGLVPISIIGAEDEDFENELETNAEEQNSQFQSLEQVKRRPVHLIAL
LQHVALQFEPAPLLCCLHADMLSTLGPKEFKKAFIDFYHSFLDKTAVLRVSVPANVAFEL
DRTRPDLISEDIQRRFVQEVVQSQQAAISRQLEDFRSKRLMGMTPWEQELAHLEAWAGRD
RTTYEARERLTAERLLTHLEEMQPTISTDEEKSAAVVNAISVYMRHLGVRTKSGDKKSGR
NFFRKKRPNLNRRPDEPPKTKKGLSSILDAARWNRGEPQVPDFRHLKIEAEADKQGSTER
KGGLAVPSRDRNVGVPGQDTLGVSLHPLSGDSPDREPGVDPPLELGDLPLQGPTNLEPPA
APESTEEGADTERCAGLSGRLGRSESLRVSDRRRPSRGSLGAKGRGGGRSRSDVDMDPSS
ATAVLGPARRATPEPGDEGEPGRLGLELEPEEPPGWRELVPPDTLHSLPKSQVKRQEVIS
ELLVTEAAHVRMLRVLHDLFYQPMAEGGFFPQDELQNIFPSLDELIEVHSLFLDSLMKRR
QDSGYLIEEIGDVLLARFDGAEGTWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFVQD
AESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPAERKKVERAAECCREILHHV
NQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTKDK
AVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATDH
KAFYVIFTWDQEAQIYELVAQTVSERKNWCALITETAGSLKVPAPASRPKPPRTSPSSTR
EPLLSSSENSNGGREMPPPDGRMERILSDLLPFCRPGPEGQLAATALQKVLSLKQLLLPV
KEDSGAGPPREGDGVPGGGPLSLSQTQKVQEKLLSLEETVKRLEEMEEEFCRLRLLLSQL
GTLLPSLAAPEDSALTG
Download sequence
Identical sequences G3TXL4
ENSLAFP00000020322 ENSLAFP00000020322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]