SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000020352 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000020352
Domain Number 1 Region: 537-625
Classification Level Classification E-value
Superfamily PH domain-like 5.29e-20
Family Third domain of FERM 0.0031
Further Details:      
 
Domain Number 2 Region: 348-434
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-17
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 3 Region: 238-289
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000458
Family Second domain of FERM 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000020352
Domain Number - Region: 452-536
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000119
Family Second domain of FERM 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000020352   Gene: ENSLAFG00000009071   Transcript: ENSLAFT00000025971
Sequence length 650
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_71:5248918:5264408:-1 gene:ENSLAFG00000009071 transcript:ENSLAFT00000025971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGMKTASGDYIDSSWELRVFVGEEDPEAESVTLRVTGESHIGGVLLKIVEDIKRKQDWS
DHAIWWEQKRQWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRALRLRASFSQPL
FQAVAAICRLLSIRHPEELSLLRAPEEEVYDLSKVVLAGGVAPALFRGMPAHFSDSAQTE
ACYHMLSRPQPPPDPLLLQRLPRPTAMLDKTQVHSRWLDSSRCLMQQGVKAGDMLWLRFK
YYSFFDLDPKMDPVRLTQLYEQARWDLLLEEIDCTEEEMMVFAALQYHINKLSQSGEVGE
PVGTDPGLDDLDAALSNLEVKLEGSASTDVLDSLTTIPELKDYLRIFRPRKLTLKGYRQH
WVVFKETTLSYYKSKDEAPGDPIQQLNLKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIY
LRCQDEQQYAHWMACGLASKGRTMADSSYASEVQAILAFLSLQRAGTGGSGNQSQSPDTS
TEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLSEAQLRFIQAWQSLPDFGISY
FLVRFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNVNWDIRQVAIEFDEHI
NVAFSCVSASCRIVHEYIGGYIFLSTRERARGEELDEDLFLQLTGGHEAF
Download sequence
Identical sequences G3TXP4
ENSLAFP00000020352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]