SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000020358 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000020358
Domain Number 1 Region: 105-328
Classification Level Classification E-value
Superfamily vWA-like 1.11e-72
Family Integrin A (or I) domain 0.00000000161
Further Details:      
 
Domain Number 2 Region: 324-414
Classification Level Classification E-value
Superfamily Integrin domains 2.35e-33
Family Integrin domains 0.00000381
Further Details:      
 
Domain Number 3 Region: 580-664
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.83e-23
Family Integrin beta tail domain 0.00000513
Further Details:      
 
Domain Number 4 Region: 2-55
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000183
Family Plexin repeat 0.0000496
Further Details:      
 
Domain Number 5 Region: 538-579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family Integrin beta EGF-like domains 0.00034
Further Details:      
 
Domain Number 6 Region: 496-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000257
Family Integrin beta EGF-like domains 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000020358
Domain Number - Region: 465-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family Integrin beta EGF-like domains 0.015
Further Details:      
 
Domain Number - Region: 424-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0865
Family Integrin beta EGF-like domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000020358   Gene: ENSLAFG00000014156   Transcript: ENSLAFT00000026082
Sequence length 736
Comment pep:novel supercontig:loxAfr3:scaffold_31:27777194:27810875:1 gene:ENSLAFG00000014156 transcript:ENSLAFT00000026082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SICATRGVSSCQQCLAVSPMCAWCSDKALPVGTARCNLKENLLKDNCAPESIEFPISEAR
VLEDRPLSDKGSGDSSQVTQVTPQKIALRLRPDDSKNFSVQVRQVEDYPVDIYYLMDLSY
SMKDDLWSIQSLGTNLASQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALKNPCYDMKT
TCLPMFGYKHVLTLTDQVTLMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIV
QPNDGQCHIGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIP
GTTVGVLSKDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLDNEVIPGLKSC
VGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLTVQVTFDCDCACQAQAQPHSP
RCNNGNGTFECGVCRCEPGWLGTQCECSEEDYRPSQQDECSPRGGQPLCSQRGECLCGQC
VCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDT
CMSSNGLLCSGRGKCECGSCVCTQPGSYGDTCEKCPTCPDACTFKKQCVECKKFDRGELH
EENTCNRDCRDEIELVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPD
CPKGPDILVVLLSVMGAILLIGLATLLIWKLLITIHDRKEFAKFEEERARAKWDTANNPL
YKQATSTFTNITYRGN
Download sequence
Identical sequences G3TXQ0
ENSLAFP00000020358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]