SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000020632 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000020632
Domain Number 1 Region: 46-185
Classification Level Classification E-value
Superfamily PH domain-like 2.26e-43
Family Third domain of FERM 0.000000446
Further Details:      
 
Domain Number 2 Region: 343-430
Classification Level Classification E-value
Superfamily Moesin tail domain 2.62e-33
Family Moesin tail domain 0.0000222
Further Details:      
 
Domain Number 3 Region: 1-45
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000785
Family Second domain of FERM 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000020632
Domain Number - Region: 180-324
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.00615
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000020632   Gene: ENSLAFG00000014920   Transcript: ENSLAFT00000028610
Sequence length 430
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_35:21951717:21980694:-1 gene:ENSLAFG00000014920 transcript:ENSLAFT00000028610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PCSVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKG
TELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPR
LRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERAQTEVKLIKEISV
EQYNNLRNREFEELMERLRQIEEQTMKAQKELEEQTRRALELDQERKRAKEAAERLEKER
QAAEEAKAAIEKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQ
EDLEKTKEELKTVMSTPPPPPPPPVIPPTENEHDEHDENNAEASAELSNEGVMNHRSEEE
RVTETQKNERVKKQLQALSSELAQARDETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNT
KQRIDEFEAM
Download sequence
Identical sequences G3TYH4
ENSLAFP00000020632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]