SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000021467 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000021467
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.48e-28
Family Nuclear receptor 0.00011
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000021467
Domain Number - Region: 64-78,173-216
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.000477
Family Nuclear receptor ligand-binding domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000021467   Gene: ENSLAFG00000012757   Transcript: ENSLAFT00000029439
Sequence length 226
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_6:18410864:18451778:-1 gene:ENSLAFG00000012757 transcript:ENSLAFT00000029439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRNCLIDRTNRNRCQHCRLQKCLA
LGMSRDAVKFGRMSKKQRDSLYAEGGEAEALVRVYNSSISNSLSNLNNETSSTYANGHII
DLPKSEGYYSVDSGQPSPDQSGLDITGIKQIKQEPIYDLTSVPNLFTYSPFNNGQLAPGI
TMTEIDRIAQNIIKSHLETCQYTMEELHQLAWQTHTYEEIKAYQSK
Download sequence
Identical sequences G3U0V9
ENSLAFP00000021467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]