SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000021812 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000021812
Domain Number 1 Region: 480-777
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.61e-85
Family Pancreatic carboxypeptidases 0.00000000154
Further Details:      
 
Domain Number 2 Region: 59-364
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.27e-79
Family Pancreatic carboxypeptidases 0.00000146
Further Details:      
 
Domain Number 3 Region: 905-1194
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.98e-67
Family Pancreatic carboxypeptidases 0.0000123
Further Details:      
 
Domain Number 4 Region: 777-857
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 7.06e-19
Family Carboxypeptidase regulatory domain 0.0000291
Further Details:      
 
Domain Number 5 Region: 365-443
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.02e-16
Family Carboxypeptidase regulatory domain 0.00057
Further Details:      
 
Domain Number 6 Region: 1195-1293
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000000000451
Family Carboxypeptidase regulatory domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000021812   Gene: ENSLAFG00000002399   Transcript: ENSLAFT00000026203
Sequence length 1361
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_47:3274195:3338137:1 gene:ENSLAFG00000002399 transcript:ENSLAFT00000026203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSAWELVAVKKLRVTPKNLPLLLCLLLLRTPAQAAHIKKAEATTTTTSAGAQAAEGQFD
RYYHQEELSSVLREVAAAASPGLARLFSIGRSVEGRPLWVLRLTAGLEPPPPDVKLVGNM
HGDETVSRQVLVYLARELVAGYRRGDPRLVRLLNTTDVYVMPSLNPDGFERAREGDCGLG
DGEPPGPTGRDNSRGRDLNRSFPDQFRTGEPPALDDVPEVRALIDWIRRNKFVLSGNLHG
GSVVASYPFDDSPEHKVSGIYSKTSDDEVFKYLAKAYASNHPIMKTGAPHCPGDEDETFK
DGITNGAHWYDVEGGMQDYNYVWANCFEITLELSCCKYPPASQLKQEWENNRESLITLIE
KVHIGVKGFVKDSVTGSGLENATISVAGINHNITTGRFGDFHRLLVPGTYNLTAVLTGYM
PLTFNNITVKEGPATEVNFSLRPTVTSVIPDTTEAVAIASTVAIPNIPPGTPSSHQPIQP
KDFHHHHFPDMEIFLRRFANEYPNITRLYSLGKSVESRELYVMEISDNPGVHEPGEPEFK
YIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVRSTRIHLMPSMNPDGYEKAQEGD
SISVVGRNNSNNFDLNRNFPDQFVQITDPTQPETIAVMSWMKAYPFVLSANLHGGSLVVN
YPYDDDEQGLATYSKSPDDAVFQQIALSYSKENFQMFQGRPCKNIYPTEYFPHGITNGAN
WYNVPGGMQDWNYLHTNCFEVTVELGCVKYPFEKDLPKLWEQNRRSLIQFMKQVHQGVRG
FVLDATDGRGILNATISVAEINHPVTTYKTGDYWRLLVPGTYKITASARGYNPVTKNVTV
KSEGAIQVNFTLVRSSTDSNSESKKGKGDSTNTDGASDPTTKEFETLIKDLSAENGLEDL
ILRSSSNLALYRYHSYKDLSEFLRGLVMNYPQITNLTSLGQSAEYRHIWSLEISNKPNVS
EPEEPKIRFVAGIHGNAPVGTELLLALAEFLCLNYKKNPAVTQLIDRTRIVIVPSLNPDG
RERAQEKDCTSKTGQTNAHGKDLDTDFTNNASQPETKAVIENLIQKQDFSLSVALDGGSV
LVTYPYDKPVQTVVENRETLKHLASLYANNHPSMHMGQPSCPNKSDENIPGGVMRGAEWH
SHLGSMKDYSVTYGHCPEITVYTSCCYFPTAAQLPSLWAENKKSLLSMLVEVHKGVHGFV
KDKSGKPVSKAVIVLNEGIKVHTKEGGYFHVLLAPGFHNINAIADGYQQQHSQVFVHHDA
ASSVVIVFDTDNRIFGLPRELVVTVSGATMSALILTACIIWCICSIKSNRHKDGFHRLRQ
HHDEYEDEIRMMSTGSKKSLLSHEFQDETDTEEETLYSSKH
Download sequence
Identical sequences G3U1V4
ENSLAFP00000021812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]