SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000022280 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000022280
Domain Number 1 Region: 35-147
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000552
Further Details:      
 
Domain Number 2 Region: 242-371
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.7e-29
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 430-490
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000123
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000022280   Gene: ENSLAFG00000010329   Transcript: ENSLAFT00000028068
Sequence length 502
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_56:1581310:1588566:1 gene:ENSLAFG00000010329 transcript:ENSLAFT00000028068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGTVGGRPGGHGGPGVQQNIPSTLLRDHENQRLFEMLGRKCWTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRMLWEQELYSQLVYSTPTPFFHTFAGD
DCQAGLNFADEGEAQSFQALVQEKIRKRNQRQSGDRRQLLPTPAPANEERRGGLPPLPPH
PGGDLGGPPAGPPALGLVTVDIQNPDITSSRYRGLPAPGPGPVDKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGL
EAVRQEMRRQEPLPPPPPPSRGGNQPPRPPTMGGNKGRSGPLPPVPLGGTPPPPTPRGPP
PPGRGGPPPPPPPATGRSGPPPPPPPGAGGPPLPPPPPPPPPPPSSGDGPVAPAPPPALG
SGGGLAPGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQSSEGLVGALMHVMQKRSRA
IHSSDEGEDQAGDEDEDDEWDD
Download sequence
Identical sequences G3U372
ENSLAFP00000022280 ENSLAFP00000022280 XP_010596009.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]